Welcome, please Login here

» Endo-arabinanase

  • GBP
  • Euro
  • USD

Your currency for this session has been set to Euro.

  • Catalog #
    Size
    Price
    Qty
     
  • PRO-E0354-32.1 U
    32.1 U
    11.90
  • PRO-E0354-2 mg
    2 mg
    11.90
  • PRO-E0354-321 U
    321 U
    83.30
  • PRO-E0354-20 mg
    20 mg
    83.30
  • PRO-E0354-3210 U
    3210 U
    535.50
  • PRO-E0354-200 mg
    200 mg
    535.50
  • PRO-E0354-32.1 KU
    32.1 KU
    2,320.50
  • PRO-E0354-2 g
    2 g
    2,320.50

Catalogue No.:
PRO-E0354

LOT:
2009-0354

Source Organism:
Streptomyces coelicolor A3(2)

Enzyme Properties


  • PDF Downloads
  • Product Specification Sheet
    Download
  • Material Safety Data Sheet
    Download

EC No.:
3.2.1.99

Synonyms:
Arabinanase; arabinan endo-1,5-α-L-arabinosidase; endo-1,5-α-L-arabinanase; endo-α-1,5-arabanase; endo-arabanase; 1,5-α-L-arabinan 1,5-α-L-arabinanohydrolase; 5-α-L-arabinan 5-α-L-arabinanohydrolase; arabinan endo-1,5-alpha-L-arabinosidase; endo-1,5-alpha-L-arabinanase; endo-alpha-1,5-arabanase; endo-arabanase; 1,5-α-L-arabinan 1,5-α-L-arabinanohydrolase; 5-alpha-L-arabinan 5-alpha-L-arabinanohydrolase

Nomenclature:
CAZy [GH43, glycoside hydrolase family 43, member of clan GH-F], SCO2427, SCC42.08c

Specific Activity:
16.05 U/mg (4 mg/mL sugar beet arabinan)

Accession No.:
Q9KXY8, CAB92901, NP_626671

Molecular Weight:
33858.2 Da

Biological Function:
Catalyses the endohydrolysis of (1→5)-α-arabinofuranosidic linkages in (1→5)-arabinans

Comments:
-

Primary Sequence


MYPNPGRVTGSVVTHDPTMIRTSSGQYRLYATGGGISSKASSDRTAFSAGADAFGSRPGWWSRYSSVPEA
WAPDISYHGGKYLMYYSVSSFGSNTSAIGLAGSTTGAPGSWSDYGIVYTSGSASDYNAIDPNLFVDDDGT
WWLSFGSWWTGIKMIRIDPATGKQLASDTARRSLASRPTGTKAVEAPYVVKRNGYYYLFASYDTCCAGTG
STYKVKVGRATSVTGPYRDRNGVAMTDNGGTPVLESHGSVIGPGGQSIMNDVDGDLIVYHYYDGNDNGTP
KLGINLLDWSSGWPVAY