Welcome, please Login here

» α-Glucuronidase

  • GBP
  • USD
  • Euro
  • Catalog #
    Size
    Price
    Qty
     
  • PRO-E0069-55.44 U
    55.44 U
    10.00
  • PRO-E0069-2 mg
    2 mg
    10.00
  • PRO-E0069-554.4 U
    554.4 U
    70.00
  • PRO-E0069-20 mg
    20 mg
    70.00
  • PRO-E0069-5544 U
    5544 U
    450.00
  • PRO-E0069-200 mg
    200 mg
    450.00
  • PRO-E0069-55.4 KU
    55.4 KU
    1,950.00
  • PRO-E0069-2 g
    2 g
    1,950.00

Catalogue No.:
PRO-E0069

LOT:
2009-0069

Source Organism:
Cellvibrio japonicus NCIMB 10462

Enzyme Properties


  • PDF Downloads
  • Product Specification Sheet
    Download
  • Material Safety Data Sheet
    Download

EC No.:
3.2.1.139

Synonyms:
α-Glucosiduronase; α-D-glucosiduronate glucuronohydrolase; alpha-glucuronidase; alpha-glucosiduronase; alpha-D-glucosiduronate glucuronohydrolase

Nomenclature:
CAZy [GH67, glycoside hydrolase family 67]

Specific Activity:
27.72 U/mg (aldouronic acid mixture)

Accession No.:
Q8VP74, AAL57752

Molecular Weight:
97904.6 Da

Biological Function:
Catalyses the release of 4-O-methyl-D-glucuronic acid from 4-O-methyl-D-glucuronoxylooligosaccharides but not from 4-O-methyl-D-glucuronoxylan

Comments:
PDB: 1GQI, 1GQJ, 1GQK, 1GQL, 1H41

Primary Sequence


AQTEDGYDMWLRYQPIADQTLLKTYQKQIRHLHVAGDSPTINAAAAELQRGLSGLLNKPIVARDEKLKDY
SLVIGTPDNSPLIASLNLGERLQALGAEGYLLEQTRINKRHVVIVAANSDVGVLYGSFHLLRLIQTQHAL
EKLSLSSAPRLQHRVVNHWDNLNRVVERGYAGLSLWDWGSLPNYLAPRYTDYARINASLGINGTVINNVN
ADPRVLSDQFLQKIAALADAFRPYGIKMYLSINFNSPRAFGDVDTADPLDPRVQQWWKTRAQKIYSYIPD
FGGFLVKADSEGQPGPQGYGRDHAEGANMLAAALKPFGGVVFWRAFVYHPDIEDRFRGAYDEFMPLDGKF
ADNVILQIKNGPIDFQPREPFSALFAGMSRTNMMMEFQITQEYFGFATHLAYQGPLFEESLKTETHARGE
GSTIGNILEGKVFKTRHTGMAGVINPGTDRNWTGHPFVQSSWYAFGRMAWDHQISAATAADEWLRMTFSN
QPAFIEPVKQMMLVSREAGVNYRSPLGLTHLYSQGDHYGPAPWTDDLPRADWTAVYYHRASKTGIGFNRT
KTGSNALAQYPEPIAKAWGDLNSVPEDLILWFHHLSWDHRMQSGRNLWQELVHKYYQGVEQVRAMQRTWD
QQEAYVDAARFAQVKALLQVQEREAVRWRNSCVLYFQSVAGRPIPANYEQPEHDLEYYKMLARTTYVPEP
WHPASSSRVLK