Welcome, please Login here

» Licheninase

  • GBP
  • Euro
  • USD
  • Catalog #
    Size
    Price
    Qty
     
  • PRO-E0017-2100
    2100U
    51.00
  • PRO-E0017-6300
    6300U
    138.00

Catalogue No.:
PRO-E0017

LOT:
2008-0017

Source Organism:
Clostridium thermocellum NCIB 10682

Enzyme Properties


  • PDF Downloads
  • Product Specification Sheet
    Download
  • Material Safety Data Sheet
    Download

EC No.:
3.2.1.73

Synonyms:
Lichenase; β-(1→4)-D-glucan 4-glucanohydrolase; 1,3;1,4-β-glucan endohydrolase; 1,3;1,4-β-glucan 4-glucanohydrolase; 1,3-1,4-β-D-glucan 4-glucanohydrolase; (1→3)-(1→4)-β-D-glucan 4-glucanohydrolase; beta-(1→4)-D-glucan 4-glucanohydrolase; 1,3;1,4-beta-glucan endohydrolase; 1,3;1,4-beta-glucan 4-glucanohydrolase; 1,3-1,4-beta-D-glucan 4-glucanohydrolase; (1→3)-(1→4)-beta-D-glucan 4-glucanohydrolase

Nomenclature:
CAZy [GH26, glycoside hydrolase family 26, member of clan GH-A], CtGH26

Specific Activity:
700 U/mg

Accession No.:
AAA23225

Molecular Weight:
32517.1 Da

Biological Function:
Catalyses the hydrolysis of (1→4)-β-D-glucosidic linkages in β-D-glucans containing (1→3)- and (1→4)-bonds

Comments:
Does not hydrolyse β-D-glucans containing only 1,3- or 1,4-bonds

Primary Sequence


MLKIGAWVGTQPSESAIKSFQELQGRKLDIVHQFINWSTDFSWVRPYADAVYNNGSILMITWEPWEYNTV
DIKNGKADAYITRMAQDMKAYGKEIWLRPLHEANGDWYPWAIGYSSRVNTNETYIAAFRHIVDIFRANGA
TNVKWVFNVNCDNVGNGTSYLGHYPGDNYVDYTSIDGYNWGTTQSWGSQWQSFDQVFSRAYQALASINKP
IIIAEFASAEIGGNKARWITEAYNSIRTSYNKVIAAVWFHENKETDWRINSSPEALAAYREAIGAG