Welcome, please Login here

» Cellulase

  • GBP
  • Euro
  • USD
  • Catalog #
    Size
    Price
    Qty
     
  • PRO-E0020-300
    300U
    51.00
  • PRO-E0020-900
    900U
    138.00

Catalogue No.:
PRO-E0020

LOT:
2008-0020

Source Organism:
Clostridium thermocellum F1

Enzyme Properties


  • PDF Downloads
  • Product Specification Sheet
    Download
  • Material Safety Data Sheet
    Download

EC No.:
3.2.1.4

Synonyms:
Endo-1,4-β-D-glucanase; β-1,4-glucanase; β-1,4-endoglucan hydrolase; celluase A; cellulosin AP; endoglucanase D; alkali cellulase; cellulase A 3; celludextrinase; 9.5 cellulase; avicelase; pancellase SS; 1,4-(1,3;1,4)-β-D-glucan 4-glucanohydrolase; 4-(1,3;1,4)-β-D-glucan 4-glucanohydrolase; endo-1,4-beta-D-glucanase; beta-1,4-glucanase; beta-1,4-endoglucan hydrolase; 1,4-(1,3;1,4)-beta-D-glucan 4-glucanohydrolase; 4-(1,3;1,4)-beta-D-glucan 4-glucanohydrolase

Nomenclature:
CAZy [GH44, glycoside hydrolase family 44]

Specific Activity:
150 U/mg

Accession No.:
BAA12070

Molecular Weight:
58116.4 Da

Biological Function:
Catalyses the endohydrolysis of (1→4)-β-D-glucosidic linkages in cellulose, lichenin and cereal β-D-glucans

Comments:
Also hydrolyses 1,4-linkages in β-D-glucans also containing 1,3-linkages

Primary Sequence


MAKVVDIRIDTSAERKPISPYIYGSNQELDATVTAKRFGGNRTTGYNWENNFSNAGSDWLHYSDTYLLED
GGVPKGEWSTPASVVTTFHDKALSKNVPYTLITLQAAGYVSADGNGPVSQEETAPSSRWKEVKFEKGAPF
SLTPDTEDDYVYMDEFVNYLVNKYGNASTPTGIKGYSIDNEPALWSHTHPRIHPDNVTAKELIEKSVALS
KAVKKVDPYAEIFGPALYGFAAYETLQSAPDWGTEGEGYRWFIDYYLDKMKKASDEEGKRLLDVLDVHWY
PEARGGGERICFGADPRNIETNKARLQAPRTLWDPTYIEDSWIGQWKKDFLPILPNLLDSIEKYYPGTKL
AITEYDYGGGNHITGGIAQADVLGIFGKYGVYLATFWGDASNNYTEAGINLYTNYDGKGGKFGDTSVKCE
TSDIEVSSAYASIVGEDDSKLHIILLNKNYDQPTTFNFSIDSSKNYTIGNVWAFDRGSSNITQRTPIVNI
KDNTFTYTVPALTACHIVLEAAE