Welcome, please Login here

» Endo-1,4-β-galactanase

  • GBP
  • Euro
  • USD
  • Catalog #
    Size
    Price
    Qty
     
  • PRO-E0023-15000
    15000U
    51.00
  • PRO-E0023-45000
    45000U
    138.00

Catalogue No.:
PRO-E0023

LOT:
2008-0023

Source Organism:
Clostridium thermocellum ATCC 27405

Enzyme Properties


  • PDF Downloads
  • Product Specification Sheet
    Download
  • Material Safety Data Sheet
    Download

EC No.:
3.2.1.89

Synonyms:
Galactanase; arabinogalactanase; arabinogalactan 4-β-D-galactanohydrolase; endo-1,4-beta-galactanase; arabinogalactan 4-beta-D-galactanohydrolase

Nomenclature:
CAZy [GH53, glycoside hydrolase family 53, member of clan GH-A], galactanase 53A

Specific Activity:
10000 U/mg

Accession No.:
ABN52631

Molecular Weight:
36405.3 Da

Biological Function:
Catalyses the endohydrolysis of (1→4)-β-D-galactosidic linkages in arabinogalactans

Comments:
-

Primary Sequence


MAPTFAKGADVSWLPEMEANGYKFYNDDGIEQDCLQILKDHGIDSIRLRVWVNPPNGYCNKEETIKMALR
AKKMGFRIMINFHYSDSWADPGKQTKPAAWAKYDFNGLMKAVYDYTYDVMSALKANGITPEWVQVGNETN
NGMLWEDGKATNSMRNFAWLINCGYDAVKAVSPETKVIVHIANGYDNALYRWIFDGITANGARFDVIGMS
LYPTASDWPQLTNQCLNNMKDMISRYGKEIMICEIGMDYWEAQACKDFITDIIQKTKSLPDNKGLGVFYW
EPQCYNWQYYNKGAFDLSGKPTIALDAFLT