Welcome, please Login here

» Galactan 1,3-β-galactosidase

  • GBP
  • Euro
  • USD
  • Catalog #
    Size
    Price
    Qty
     
  • PRO-E0024-16
    16U
    51.00
  • PRO-E0024-48
    48U
    138.00

Catalogue No.:
PRO-E0024

LOT:
2008-0024

Source Organism:
Clostridium thermocellum ATCC 27405

Enzyme Properties


  • PDF Downloads
  • Product Specification Sheet
    Download
  • Material Safety Data Sheet
    Download

EC No.:
3.2.1.145

Synonyms:
Exo-β-1,3-galactosidase; galactan 3-β-D-galactosidase; exo-beta-1,3-galactosidase; galactan 1,3-beta-galactosidase; galactan 3-beta-D-galactosidase

Nomenclature:
CAZy [GH43, glycoside hydrolase family 43, member of clan GH-F], exo-β-1,3-galactanase 43A

Specific Activity:
20 U/mg

Accession No.:
ABN51896

Molecular Weight:
37692 Da

Biological Function:
Catalyses the hydrolysis of terminal, non-reducing β-D-galactose residues in (1→3)-β-D-galactopyranans

Comments:
This enzyme removes not only free galactose, but also 6-glycosylated residues, e.g., (1→6)-β-D-galactobiose, and galactose bearing oligosaccharide chains on O-6. Hence, it releases branches from [arabino-galacto-(1→6)]-(1→3)-β-D-galactans

Primary Sequence


MAEGVIVNGTQFKDTSGNVIHAHGGGMLKHGDYYYWYGEYRDDSNLFLGVSCYRSKDLVNWEYRGEVLSR
NSAPELNHCNIERPKVMYNASTGEFVMWMHWENGINYGQARAAVAYSKTPDGKFTYIRSFRPMQDTGVMD
HGLPGYMSRDCNVFVDTDGKGYFISAANENMDLHLYELTPDYKNIASLKAKLFVGQQREAPCLIKRNGYY
YLITSGCTGWNPNQAKYAYSKDLASGWSQLYNLGNSTTYRSQPTFIIPVQGSSGTSYLYMGDRWAGAWGG
KVNDSQYVWLPLNFISDTTLELPYYDSVKIDASSGIISEYIPDT