Welcome, please Login here

» β-Glucosidase

  • GBP
  • USD
  • Euro
  • Catalog #
    Size
    Price
    Qty
     
  • PRO-E0025-20
    20U
    51.00
  • PRO-E0025-60
    60U
    138.00

Catalogue No.:
PRO-E0025

LOT:
2009-0025 (09091)

Source Organism:
Clostridium thermocellum DSM 1237

Enzyme Properties


  • PDF Downloads
  • Product Specification Sheet
    Download
  • Material Safety Data Sheet
    Download

EC No.:
3.2.1.21

Synonyms:
Gentiobiase; cellobiase; emulsin; elaterase; aryl-β-glucosidase; β-D-glucosidase; β-glucoside glucohydrolase; arbutinase; amygdalinase; p-nitrophenyl β-glucosidase; primeverosidase; amygdalase; limarase; salicilinase; β-1,6-glucosidase; β-D-glucoside glucohydrolase; aryl-beta-glucosidase; beta-glucosidase; beta-D-glucosidase; beta-glucoside glucohydrolase; p-nitrophenyl beta-glucosidase; beta-1,6-glucosidase; beta-D-glucoside glucohydrolase

Nomenclature:
CAZy [GH1, glycoside hydrolase family 1, member of clan GH-A], glucosidase 1A

Specific Activity:
33 U/mg

Accession No.:
CAA42814

Molecular Weight:
52700 Da

Biological Function:
Hydrolysis of terminal, non-reducing β-D-glucosyl residues with release of β-D-glucose, substrates attacked include cellobiose and p-nitrophenyl-β-D-glucopyranoside

Comments:
Wide specificity for β-D-glucosides (may also hydrolyse β-D-galactosides, α-L-arabinosides, β-D-xylosides, and/or β-D-fucosides)

Primary Sequence


MSKITFPKDFIWGSATAAYQIEGAYNEDGKGESIWDRFSHTPGNIADGHTGDVACDHYHRYEEDIKIMKE
IGIKSYRFSISWPRIFPEGTGKLNQKGLDFYKRLTNLLLENGIMPAITLYHWDLPQKLQDKGGWKNRDTT
DYFTEYSEVIFKNLGDIVPIWFTHNEPGVVSLLGHFLGIHAPGIKDLRTSLEVSHNLLLSHGKAVKLFRE
MNIDAQIGIALNLSYHYPASEKAEDIEAAELSFSLAGRWYLDPVLKGRYPENALKLYKKKGIELSFPEDD
LKLISQPIDFIAFNNYSSEFIKYDPSSESGFSPANSILEKFEKTDMGWIIYPEGLYDLLMLLDRDYGKPN
IVISENGAAFKDEIGSNGKIEDTKRIQYLKDYLTQAHRAIQDGVNLKAYYLWSLLDNFEWAYGYNKRFGI
VHVNFDTLERKIKDSGYWYKEVIKNNGF