Welcome, please Login here

» β-Mannanase

  • GBP
  • USD
  • Euro
  • Catalog #
    Size
    Price
    Qty
     
  • PRO-E0026-1500
    1500U
    51.00
  • PRO-E0026-4500
    4500U
    138.00

Catalogue No.:
PRO-E0026

LOT:
2012-0026 (Batch 12051)

Source Organism:
Clostridium thermocellum YS

Enzyme Properties


  • PDF Downloads
  • Product Specification Sheet
    Download
  • Material Safety Data Sheet
    Download

EC No.:
3.2.1.78

Synonyms:
Mannan endo-1,4-β-mannosidase; endo-1,4-β-mannanase; endo-β-1,4-mannase; β-mannanase B; β-1, 4-mannan 4-mannanohydrolase; endo-β-mannanase; β-D-mannanase; 1,4-β-D-mannan mannanohydrolase; beta-mannanase; mannan endo-1,4-beta-mannosidase; endo-1,4-beta-mannanase; endo-beta-1,4-mannase; beta-mannanase B; beta-1, 4-mannan 4-mannanohydrolase; endo-beta-mannanase; beta-D-mannanase; 1,4-beta-D-mannan mannanohydrolase

Nomenclature:
CAZy [GH26, glycoside hydrolase family 26, member of clan GH-A], mannanase 26A

Specific Activity:
1500 U/mg

Accession No.:
CAB52403

Molecular Weight:
42700 Da

Biological Function:
Catalyses the random hydrolysis of 1,4-β-D-mannosidic linkages in mannans, galactomannans and glucomannans

Comments:
Note: different to β-mannosidase (EC 3.2.1.25)

Primary Sequence


ADESIVELKVPKKLVNPNATKEAKALMSYLVDIYGKHILSGQQEICGSHNYPGSEAEFTYIQEKTGKLPA
VRGFDFMNYRGNGLMWDDQCAERVIEWYKEKGGIPTVCWHWFSPGDIGKKADNSFYTESTTFSISRALTP
GTEENIALLNDIDTIARKLKQVQDAGVPVLFRPLHEAEGGWFWWGAEGPEPCVRLYRLLYDKFTNEYGLN
NLIWVWTSYDYETSAAWYPGDDVVDIIGYDKYNAKDGKPNGSAISSTFYNLVKLTNGKKLVAMTENDTIP
RVSNLVNEKAGWLYFCPWYGWWLTSEQNNPVDWLVEMYQSDYCITLDELPDLKNYPISDYEDSN