Welcome, please Login here

» β-Mannosidase

  • GBP
  • USD
  • Euro
  • Catalog #
    Size
    Price
    Qty
     
  • PRO-E0124-5.32 U
    5.32 U
    10.00
  • PRO-E0124-1 mg
    1 mg
    10.00
  • PRO-E0124-53.2
    53.2
    70.00
  • PRO-E0124-10 mg
    10 mg
    70.00
  • PRO-E0124-532
    532
    450.00
  • PRO-E0124-100 mg
    100 mg
    450.00
  • PRO-E0124-5320 U
    5320 U
    1,850.00
  • PRO-E0124-1 g
    1 g
    1,850.00

Catalogue No.:
PRO-E0124

LOT:
2011-0124-1

Source Organism:
Bacteroides fragilis NCTC 9343

Enzyme Properties


  • PDF Downloads
  • Product Specification Sheet
    Download
  • Material Safety Data Sheet
    Download

EC No.:
3.2.1.25

Synonyms:
Mannanase; mannase; β-D-mannosidase; β-mannoside mannohydrolase; exo-β-D-mannanase; β-D-mannoside mannohydrolase; beta-mannosidase; beta-D-mannosidase; beta-mannoside mannohydrolase; exo-beta-D-mannanase; beta-D-mannoside mannohydrolase

Nomenclature:
CAZy [GH2, glycoside hydrolase family 2, member of clan GH-A], bmnA, BF1810

Specific Activity:
-

Accession No.:
Q5LEE2, YP_211446.1, BFRA272559:BF1810-MONOMER, CAH07509.1

Molecular Weight:
100520.1 Da

Biological Function:
Catalyses the hydrolysis of terminal, non-reducing β-D-mannose residues in β-D-mannosides

Comments:
Strongly inhibited by Tris/HCl buffer (also inhibited to a lesser extent by HEPES buffer)

Primary Sequence


NQDTSDVLMLNDDWSFSQVGTEKWLPATVPGTVHQDLIHHKLLPDPFYGTNEKKIQWVEDEDWEYKTCFV
VTEEQLKRDAAQLFFEGLDTYADVYLNGSLVLKSDNMFVGYAVPVKQVLRKGENLLHVYFHSPIKQTLPQ
WSSNGFNYPADNDHHEKRLSVFTRKAPYSYGWDWGIRMVTSGIWRPVTLRFYDVATIADYHVKQLSLTDQ
VAKLSNELEINSISEKEKSAEVLISYSLQGGKEVTVKKNVTLKPGLNKIHIPLDIQNPVRWMPNGWGEPH
LYDFSAQVICDGKTIASRQHRIGLRTIRVVNEKDKEGESFYFEVNGIPMFAKGANYIPDDALLPCITTER
YRTLFRDMKEANMNMVRIWGGGTYEDDRFYDLADENGILVWQDFMFACTAYPSDPTFLKRVEEEAEYNIK
RLRNHASLAMWCGNNEILEGLKYWGWQKNYTPEVYENMFRGYDKLFRGLLPAKVQELDEGRFYKHSSPYF
ANWGRPESWGIGDSHNWGVWYGKKTFESLDTDLPRFMSEFGFQSFPEMKTIATFAAPEDYQIESEVMNGH
QKSSIGNDLIRTYMERDYIVPEKFEDFVYIGLVLQGHGMRHGMEAHRRNRPYCMGTLYWQLNDSWPVVSW
SSIDYYGNWKALHYQAKRAFAPLLVNAIQEGDSLNIYLISDMLEKQSQLTLEMKVIDFNGKTLDKEVIKA
VEVPMNTSSCIVRKPLDTWVNPEQRKSSFLLLSLKDKSGRKVAEEVYFFDKTKNLELPQTAISMKVKQLD
GKCELTLSSPKLAKDVFVQIPVQGARFTDNFFDLLPGENKKITITSPEIKKGESLNITVKHVRDTYN