Welcome, please Login here

» Pectin acetylesterase

  • GBP
  • Euro
  • USD

Your currency for this session has been set to GBP.

  • Catalog #
    Size
    Price
    Qty
     
  • PRO-E0032-150
    150U
    51.00
  • PRO-E0032-450
    450U
    138.00

Catalogue No.:
PRO-E0032

LOT:
2008-0032

Source Organism:
Clostridium thermocellum

Enzyme Properties


  • PDF Downloads
  • Product Specification Sheet
    Download
  • Material Safety Data Sheet
    Download

EC No.:
3.1.1.-

Synonyms:
Pectinacetylesterase; PAE

Nomenclature:
CAZy [CE12, carbohydrate esterase family 12], 12B

Specific Activity:
100 U/mg

Accession No.:
ABN54336

Molecular Weight:
26100 Da

Biological Function:
Catalyses the hydrolysis of acetate from acetylated pectins

Comments:
-

Primary Sequence


MEEKITIYIAGDSTVQTYNASYAPQAGWGQFLGQYFTSNVVIENRAIAGRSSRSFVEEGRLDSILSVIKP
GDYLFIQFGHNDADISKPERYSAPYTTYKEYLRKYVDGARQKGAIPVLITPVARLNYKNNAFVNDFPDYC
TAMKQVAEEKNVKLIDLMTKSLNYYNSIGYNETYKLFMVSVNNTDYTHFTEKGAQQIARLVAQGVKEANL
DIAKYLKTN