Welcome, please Login here

» Acetyl xylan esterase

  • GBP
  • USD
  • Euro
  • Catalog #
    Size
    Price
    Qty
     
  • PRO-E0033-262.5
    262.5U
    51.00
  • PRO-E0033-787.5
    787.5U
    138.00

Catalogue No.:
PRO-E0033

LOT:
2008-0033

Source Organism:
Clostridium thermocellum

Enzyme Properties


  • PDF Downloads
  • Product Specification Sheet
    Download
  • Material Safety Data Sheet
    Download

EC No.:
3.1.1.72

Synonyms:
acetylxylan esterase

Nomenclature:
CAZy [CE2, carbohydrate esterase family 2], 2A

Specific Activity:
175 U/mg

Accession No.:
AAA23224

Molecular Weight:
37700 Da

Biological Function:
Deacetylation of xylans and xylo-oligosaccharides

Comments:
Also catalyses the hydrolysis of acetyl groups from acetylated xylose, acetylated glucose, α-napthyl acetate, and p-nitrophenyl acetate

Primary Sequence


MPDEDNPGILYNGRFDFSDPNGPKCAWSGSNVELNFYGTEASVTIKSGGENWFQAIVDGNPLPPFSVNAT
TSTVKLVSGLAEGAHHLVLWKRTEASLGEVQFLGFDFGSGKLLAAPKPLERKIEFIGDSITCAYGNEGTS
KEQSFTPKNENSYMSYAAITARNLNASANMIAWSGIGLTMNYGGAPGPLIMDRYPYTLPYSGVRWDFSKY
VPQVVVINLGTNDFSTSFADKTKFVTAYKNLISEVRRNYPDAHIFCCVGPMLWGTGLDLCRSYVTEVVND
CNRSGDLKVYFVEFPQQDGSTGYGEDWHPSIATHQLMAERLTAEIKNKLGW