Welcome, please Login here

» Pectin acetylesterase

  • GBP
  • Euro
  • USD

Your currency for this session has been set to USD.

  • Catalog #
    Size
    Price
    Qty
     
  • PRO-E0031-200
    200U
    $76.50
  • PRO-E0031-600
    600U
    $207.00

Catalogue No.:
PRO-E0031

LOT:
2008-0031

Source Organism:
Clostridium thermocellum

Enzyme Properties


  • PDF Downloads
  • Product Specification Sheet
    Download
  • Material Safety Data Sheet
    Download

EC No.:
3.1.1.-

Synonyms:
Pectinacetylesterase; PAE

Nomenclature:
CAZy [CE12, carbohydrate esterase family 12], 12A

Specific Activity:
100 U/mg

Accession No.:
ABN54336

Molecular Weight:
23800 Da

Biological Function:
Catalyses the hydrolysis of acetate from acetylated pectins

Comments:
-

Primary Sequence


MRTIYIGGDSTVCNYYPLDTSAQAGWGQMLHKFVDTNVFQIRNMASSGQFARGFRDDGQFEAIMKYLKPG
DIFILQFGINDTNSKNSTTEAQFKEIMTDMVVKAKATGATVVLSTPQGRATDFNSSNVHDSQGRWYRRAT
IEVAREQGVRLVDLNVLSSAYFTSIGPEATLALYMPGDTLHPNREGATQLARIVAEELADLLKA