Welcome, please Login here

» β-Xylosidase

  • GBP
  • USD
  • Euro
  • Catalog #
    Size
    Price
    Qty
     
  • PRO-E0213-53.52 U
    53.52 U
    10.00
  • PRO-E0213-2 mg
    2 mg
    10.00
  • PRO-E0213-535.2 U
    535.2 U
    70.00
  • PRO-E0213-20 mg
    20 mg
    70.00
  • PRO-E0213-5352 U
    5352 U
    450.00
  • PRO-E0213-200 mg
    200 mg
    450.00
  • PRO-E0213-53520 U
    53520 U
    1,950.00
  • PRO-E0213-2 g
    2 g
    1,950.00

Catalogue No.:
PRO-E0213

LOT:
2008-0213

Source Organism:
Lactobacillus brevis ATCC 367

Enzyme Properties


  • PDF Downloads
  • Product Specification Sheet
    Download
  • Material Safety Data Sheet
    Download

EC No.:
3.2.1.37

Synonyms:
Xylan 1,4-β-xylosidase; xylobiase; exo-1,4-β-xylosidase; β-D-xylopyranosidase; exo-1,4-xylosidase; exo-1,4-β-D-xylosidase; 1,4-β-D-xylan xylohydrolase; 4-β-D-xylan xylohydrolase; xylan 1,4-beta-xylosidase; exo-1,4-beta-xylosidase; beta-D-xylopyranosidase; exo-1,4-beta-D-xylosidase; 1,4-beta-D-xylan xylohydrolase; 4-beta-D-xylan xylohydrolase

Nomenclature:
CAZy [GH43, glycoside hydrolase family 43, member of clan GH-F]

Specific Activity:
26.76 U/mg

Accession No.:
Q03N89, YP_796364, ABJ65333

Molecular Weight:
63608.3 Da

Biological Function:
Catalyses the hydrolysis of (1→4)-β-D-xylans, to remove successive D-xylose residues from the non-reducing termini

Comments:
This enzyme also hydrolyses xylobiose and xylooligosaccharides

Primary Sequence


MKIQNPVLPGFNADPSMIRVGDTYYIANSTFEWFPGVRLHESKDLVHWNLLPSPLSTTTLLDMKGNPASG
GIWAPDLSYADGKFWLIYTDVKITEGPFKDMTNYLTTATDIRGPWTDPIAVNGVGFDASLFHDENGRKYL
VQQTWDHREYHHPFNGITLTEFDTATMQLKPETARNIYNGTDVKLVEGPHLYQINGYYYLFAAEGGTVFT
HQEVVARSKTLDELSFESEPDGPFITNMDTPDFYLQKQGHGALTSTPSGEWYYASLVSRPWNHTNESSHD
PRGWSTLGRETSIQKVEWDDAGWPRVVGGHGGQVEVDAPKDAIETTAPKDHSQHDDFDQPTLDLNWNTLR
QPFTAQMGSVGNGELKLIGQQTMSSNFDVSLIARRWQAFNFDAETKVKFDPFTYQQMAGLANIYNDKHYS
WIFITWDEKKGHVIEVAQNDNNNYTSYLKDDAIKIPDGTDYVWFRTKVRKQSYTYEYSFDGQNWETVPVE
LDAAILSDDYVLQNYGGFFTGAFVGLMAADYAGYKRVATFDYFDYQELPD