Welcome, please Login here

» Arabinoxylan arabinofuranohydrolase

  • GBP
  • Euro
  • USD

Your currency for this session has been set to USD.

  • Catalog #
    Size
    Price
    Qty
     
  • PRO-E0218-1 mg
    1 mg
    $15.00
  • PRO-E0218-10 mg
    10 mg
    $105.00
  • PRO-E0218-100 mg
    100 mg
    $675.00
  • PRO-E0218-1 g
    1 g
    $4,050.00

Catalogue No.:
PRO-E0218

LOT:
2009-0218-2

Source Organism:
Bacillus subtilis subsp. subtilis str. 168

Enzyme Properties


  • PDF Downloads
  • Product Specification Sheet
    Download
  • Material Safety Data Sheet
    Download

EC No.:
3.2.1.55

Synonyms:
α-N-Arabinofuranosidase; arabinosidase; α-arabinosidase; α-L-arabinosidase; α-arabinofuranosidase;polysaccharide α-L-arabinofuranosidase; α-L-arabinofuranoside hydrolase; L-arabinosidase; α-L-arabinanase; α-L-arabinofuranoside arabinofuranohydrolase; alpha-N-arabinofuranosidase; alpha-arabinosidase; alpha-L-arabinosidase; alpha-arabinofuranosidase;polysaccharide alpha-L-arabinofuranosidase; alpha-L-arabinofuranoside hydrolase; alpha-L-arabinanase; alpha-L-arabinofuranoside arabinofuranohydrolase

Nomenclature:
CAZy [GH43, glycoside hydrolase family 43, member of clan GH-F], XynD, xylanase D, AXH, AXH-m2,3, AXH-m23, AF

Specific Activity:
-

Accession No.:
Q45071, NP_389698.1, CAB13699.1, BSUB224308:BSU1816-MON

Molecular Weight:
53852.8 Da

Biological Function:
Catalyses the specific release of arabinose from O-2 or O-3 monosubstituted xylosyl residues in arabinoxylans and arabinoxylooligosaccharides

Comments:
PDB: 3C7E, 3C7F, 3C7G, 3C7H, 3C7O. This enzyme contains a structural calcium ion

Primary Sequence


MTTIAKHIGNSNPLIDHHLGADPVALTYNGRVYIYMSSDDYEYNSNGTIKDNSFANLNRVFVISSADMVN
WTDHGAIPVAGANGANGGRGIAKWAGASWAPSIAVKKINGKDKFFLYFANSGGGIGVLTADSPIGPWTDP
IGKPLVTPSTPGMSGVVWLFDPAVFVDDDGTGYLYAGGGVPGVSNPTQGQWANPKTARVIKLGPDMTSVV
GSASTIDAPFMFEDSGLHKYNGTYYYSYCINFGGTHPADKPPGEIGYMTSSSPMGPFTYRGHFLKNPGAF
FGGGGNNHHAVFNFKNEWYVVYHAQTVSSALFGAGKGYRSPHINKLVHNADGSIQEVAANYAGVTQISNL
NPYNRVEAETFAWNGRILTEKSTAPGGPVNNQHVTSIQNGDWIAVGNADFGAGGARSFKANVASTLGGKI
EVRLDSADGKLVGTLNVPSTGGAQTWREIETAVSGATGVHKVFFVFTGTGTGNLFNFDYWQFTQR