Welcome, please Login here

» Endo-1,4-β-galactanase

  • GBP
  • USD
  • Euro

Under Development

Catalogue No.:
PRO-E0148

LOT:
2008-0148

Source Organism:
Leuconostoc mesenteroides subs. mesenteroides ATCC 8293

Enzyme Properties


  • PDF Downloads
  • Product Specification Sheet
    Download
  • Material Safety Data Sheet
    Download

EC No.:
3.2.1.89

Synonyms:
Galactanase; arabinogalactanase; arabinogalactan 4-β-D-galactanohydrolase; endo-1,4-beta-galactanase; arabinogalactan 4-beta-D-galactanohydrolase

Nomenclature:
CAZy [GH53, glycoside hydrolase family 53, member of clan GH-A]

Specific Activity:
-

Accession No.:
ABJ62166.1

Molecular Weight:
44589.6 Da

Biological Function:
Catalyses the endohydrolysis of (1→4)-β-D-galactosidic linkages in arabinogalactans

Comments:
-

Primary Sequence


TVKKINNLNGNTIKGVDISSVISEEKSGVRYFNEEGKQENIFQILKSNGVNYIRVRVWNNPYTESGNGYG
GGNSDLAKAILIGKQASKYGMKLLVDFHYSDFWADPSKQKAPKSWQNLSYDQKQKAVYAYTLDSLQKIKQ
AGIDVGMVQIGNETNNGIAGTSKWPEMAGIFNSGSAAVRNVDKNILVAVHFTDIQKQGNDKWISKQLHDH
NVDYDVFATSYYPYWHGSLSNLTQSLSDVSRTYDKKVMVAETSYPYTYQDGDGFRNTITKDSNIVFDYPV
SVQGQATALRDVFQAVANVGSTGLGVFYWEPAWVPVGPKSNLESNRLLWEKFGSGWATKSASEFDKDAEG
NAGGSSWDNQALFNFKGKALPSLKTFKYIDTGH