Welcome, please Login here

» Pectin methylesterase

  • GBP
  • USD
  • Euro

Under Development

Catalogue No.:
PRO-E0154

LOT:
2008-0154

Source Organism:
Escherichia coli K12

Enzyme Properties


  • PDF Downloads
  • Product Specification Sheet
    Download
  • Material Safety Data Sheet
    Download

EC No.:
3.1.1.11

Synonyms:
Pectinesterase; pectin demethoxylase; pectin methoxylase; pectase; pectin methyl esterase; pectinoesterase; pectin pectylhydrolase

Nomenclature:
CAZy [CE5, carbohydrate esterase family 5]

Specific Activity:
-

Accession No.:
AAC73859.1

Molecular Weight:
45665.1 Da

Biological Function:
Catalyses the reaction: pectin + n H(2)O = n methanol + pectate

Comments:
-

Primary Sequence


TPPDQRPSDQTAPGTSSRPILSAKEAQNFDAQHYFASLTPGAAAWNPSPITLPAQPDFVVGPAGTQGVTH
TTIQAAVDAAIIKRTNKRQYIAVMPGEYQGTVYVPAAPGGITLYGTGEKPIDVKIGLSLDGGMSPADWRH
DVNPRGKYMPGKPAWYMYDSCQSKRSDSIGVLCSAVFWSQNNGLQLQNLTIENTLGDSVDAGNHPAVALR
TDGDQVQINNVNILGRQNTFFVTNSGVQNRLETNRQPRTLVTNSYIEGDVDIVSGRGAVVFDNTEFRVVN
SRTQQEAYVFAPATLSNIYYGFLAVNSRFNAFGDGVAQLGRSLDVDANTNGQVVIRDSAINEGFNTAKPW
ADAVISNRPFAGNTGSVDDNDEIQRNLNDTNYNRMWEYNNRGVGSKVVAEAKK