Welcome, please Login here

» Rhamnogalacturonan acetylesterase

  • GBP
  • USD
  • Euro

Under Development

Catalogue No.:
PRO-E0155

LOT:
2008-0155

Source Organism:
Streptomyces avermitilis MA4680

Enzyme Properties


  • PDF Downloads
  • Product Specification Sheet
    Download
  • Material Safety Data Sheet
    Download

EC No.:
3.1.1.

Synonyms:
RGAE enzyme

Nomenclature:
CAZy [CE12, carbohydrate esterase family 12]

Specific Activity:
-

Accession No.:
BAC74085.1

Molecular Weight:
28328.7 Da

Biological Function:
Removes the acetyl esters from rhamnogalacturonan; acts in synergy with rhamnogalacturonases

Comments:
Plays a key role in degradation of plant cell wall rhamnogalacturonan

Primary Sequence


TNRRARTLYIAGDSTAAQKYADAAPETGWGMALPFFLREDLTVSNHAVNGRSSKSFIDEGRLDAILEVIA
PGDFLLIQFGHNDEKSADPTRYTEPWTTYQDCLRQYVDGARARGARPVLATPVERRKFDADGNAVPTHGD
YPAAMRALAEDELVALLDIQALSIALWQKLGVEETKKYFNWTATEQDNTHFDPPGAIAVARLVAAGLLHR
RVLAPRDVRRLDAEVPESWITWPQATA