Welcome, please Login here

» Pectate lyase

  • GBP
  • USD
  • Euro

Under Development

Catalogue No.:
PRO-E0230

LOT:
2008-0230

Source Organism:
Streptomyces avermitilis MA-4680

Enzyme Properties


  • PDF Downloads
  • Material Safety Data Sheet
    Download

EC No.:
4.2.2.2

Synonyms:
Polygalacturonic transeliminase; pectic acid transeliminase; polygalacturonate lyase; endopectin methyltranseliminase; pectate transeliminase; endogalacturonate transeliminase; pectic acid lyase; pectic lyase; α-1,4-D-endopolygalacturonic acid lyase; PGA lyase; PPase-N; endo-α-1,4-polygalacturonic acid lyase; polygalacturonic acid lyase; pectin trans-eliminase; polygalacturonic acid trans-eliminase; (1→4)-α-D-galacturonan lyase; alpha-1,4-D-endopolygalacturonic acid lyase; endo-alpha-1,4-polygalacturonic acid lyase; (1→4)-alpha-D-galacturonan lyase

Nomenclature:
CAZy [PL1, polysaccharide lyase family 1]

Specific Activity:
-

Accession No.:
BAC74093.1

Molecular Weight:
35563.6 Da

Biological Function:
Catalyses the eliminative cleavage of (1→4)-α-D-galacturonan to give oligosaccharides with 4-deoxy-α-D-galact-4-enuronosyl groups at their non-reducing ends

Comments:
Shows a preference for pectate over pectin

Primary Sequence


AAAGTVIQVRAGTYYPTATLKSTADGTSSARITLQAYGSEKVKIDGSKLPAGSWLAGVYGDYWTVQNITW
QNSPAQGFVVTSSAGGVFKNLVTANNGDSGFTLRGDGTTNNLVQNLDSYGNYDAAGHGQNADGIAIKFGS
GTGNKVTGARLYNNSDDGLDLWQFSSPVTIEHSWSYGNGKNRWSDSAFEGNGNGFKLGGGGVTVAHVVNN
NAAWDNTLNGFTENSNTGAVLLNRNTAYANTEVGFYFATGKARLAKNLAVSNKGGLDKLGSSTVSAGNNW
DSGVSTPSLKSTDASTAYGARSSSGSLPSTTFLTTGSTTIGSTMN