Welcome, please Login here

» β-Xylosidase

  • GBP
  • USD
  • Euro
  • Catalog #
    Size
    Price
    Qty
     
  • PRO-E0234-20.67 U
    20.67 U
    10.00
  • PRO-E0234-1 mg
    1 mg
    10.00
  • PRO-E0234-206.7 U
    206.7 U
    70.00
  • PRO-E0234-10 mg
    10 mg
    70.00
  • PRO-E0234-2067 U
    2067 U
    450.00
  • PRO-E0234-100 mg
    100 mg
    450.00
  • PRO-E0234-20.7 KU
    20.7 KU
    1,950.00
  • PRO-E0234-1 g
    1 g
    1,950.00

Catalogue No.:
PRO-E0234

LOT:
2009-0234

Source Organism:
Bacillus subtilis subsp. subtilis str. 168

Enzyme Properties


  • PDF Downloads
  • Product Specification Sheet
    Download
  • Material Safety Data Sheet
    Download

EC No.:
3.2.1.37

Synonyms:
Xylan 1,4-β-xylosidase; xylobiase; exo-1,4-β-xylosidase; β-D-xylopyranosidase; exo-1,4-xylosidase; exo-1,4-β-D-xylosidase; 1,4-β-D-xylan xylohydrolase; 4-β-D-xylan xylohydrolase; xylan 1,4-beta-xylosidase; exo-1,4-beta-xylosidase; beta-D-xylopyranosidase; exo-1,4-beta-D-xylosidase; 1,4-beta-D-xylan xylohydrolase; 4-beta-D-xylan xylohydrolase

Nomenclature:
CAZy [GH43, glycoside hydrolase family 43, member of clan GH-F], xynB

Specific Activity:
20.67 U/mg

Accession No.:
P94489, NP_389640, BSUB224308:BSU1759-MON, AAB41091

Molecular Weight:
64909.6 Da

Biological Function:
Catalyses the hydrolysis of (1→4)-β-D-xylans, to remove successive D-xylose residues from the non-reducing termini

Comments:
PDB: 1YIF. This enzyme also hydrolyses xylobiose and xylooligosaccharides

Primary Sequence


MKITNPVLKGFNPDPSICRAGEDYYIAVSTFEWFPGVQIHHSKDLVNWHLVAHPLQRVSQLDMKGNPNSG
GVWAPCLSYSDGKFWLIYTDVKVVDGAWKDCHNYLVTCETINGDWSEPIKLNSSGFDASLFHDTDGKKYL
LNMLWDHRIDRHSFGGIVIQEYSDKEQKLIGKPKVIFEGTDRKLTEAPHLYHIGNYYYLLTAEGGTRYEH
AATIARSANIEGPYEVHPDNPILTSWHDPGNPLQKCGHASIVQTHTDEWYLAHLTGRPIHPDDDSIFQQR
GYCPLGRETAIQKLYWKDEWPYVVGGKEGSLEVDAPSIPETIFEATYPEVDEFEDSTLNINFQTLRIPFT
NELGSLTQAPNHLRLFGHESLTSTFTQAFVARRWQSLHFEAETAVEFYPENFQQAAGLVNYYNTENWTAL
QVTHDEELGRILELTICDNFSFSQPLNNKIVIPREVKYVYLRVNIEKDKYYYFYSFNKEDWHKIDIALES
KKLSDDYIRGGGFFTGAFVGMQCQDTGGNHIPADFRYFRYKEK