Welcome, please Login here

» β-Mannosidase

  • GBP
  • Euro
  • USD

Your currency for this session has been set to Euro.

  • Catalog #
    Size
    Price
    Qty
     
  • PRO-E0161-1 mg
    1 mg
    11.90
  • PRO-E0161-10 mg
    10 mg
    83.30
  • PRO-E0161-100 mg
    100 mg
    535.50
  • PRO-E0161-1 g
    1 g
    3,213.00

Catalogue No.:
PRO-E0161

LOT:
2008-0161

Source Organism:
Streptomyces coelicolor A3(2)

Enzyme Properties


  • PDF Downloads
  • Product Specification Sheet
    Download
  • Material Safety Data Sheet
    Download

EC No.:
3.2.1.25

Synonyms:
Mannanase; mannase; β-D-mannosidase; β-mannoside mannohydrolase; exo-β-D-mannanase; β-D-mannoside mannohydrolase; beta-mannosidase; beta-D-mannosidase; beta-mannoside mannohydrolase; exo-beta-D-mannanase; beta-D-mannoside mannohydrolase

Nomenclature:
CAZy [GH5, glycoside hydrolase family 5, member of clan GH-A]

Specific Activity:
-

Accession No.:
CAD55266.1

Molecular Weight:
56179.6 Da

Biological Function:
Catalyses the hydrolysis of terminal, non-reducing β-D-mannose residues in β-D-mannosides

Comments:
Note: different to β-mannanase (EC 3.2.1.78)

Primary Sequence


SPAARSAGVPSAGAQAAGLHIGDGRLLEGNGNDFVMRGVNHAHTWYPGETQSLADVKALGANSVRVVLSD
GHRWSENGPADVAAVIEQCKANRLICVLEVHDTTGYAEDAAAGTLDHAADYWIGLKDVLAGQEDYVIVNI
GNEPWGNTDPAGWTEPTVAAVKKLRAAGLQHTIMVDAPNWGQDWQGVMRANARSVYDADPTGNLIFSIHM
YSVFDTAQEITDYLNAFVDAELPILIGEFGGPADQYGDPDEDTMMATAEQLRLGYLAWSWSGNTDPVLDL
ALDFDPSRLSGWGERIFHGVNGIAQTSEEATVYGDGAPDDTEAPTAPGAPSVTAVTDSSVTLGWVAATDD
TAVSGYDVVLVGDGTSSTVASSTTTTATVTGLTAATTYTFAVHARDAAGNRSARSATVEVTTDGGGTPGG
ACSVGYRVVGEWPGGFQGEIAVRNTGSAAIGPWTLAFAFADGQTVTNMWGGTATQDAGAVSVAPASYTAT
IPAGGTVTLGFTARKGDTNTAPAAFRLNGAVCATP