Welcome, please Login here

» α-L-Arabinofuranosidase

  • GBP
  • Euro
  • USD

Under Development

Catalogue No.:
PRO-E0164

LOT:
2008-0164

Source Organism:
Streptomyces coelicolor A3

Enzyme Properties


  • PDF Downloads
  • Product Specification Sheet
    Download
  • Material Safety Data Sheet
    Download

EC No.:
3.1.1.55

Synonyms:
Alpha-N-arabinofuranosidase, Arabinofuranosidase, Arabinosidase

Nomenclature:
CAZy [GH51, glycoside hydrolase family 51, member of clan GH-A]

Specific Activity:
-

Accession No.:
CAB86096.1

Molecular Weight:
57194.1 Da

Biological Function:
Hydrolysis of terminal non-reducing alpha-L-arabinofuranoside residues in alpha-L-arabinosides (acts on alpha-L-arabinofuranosides, alpha-L-arabinans containing (1,3)- and/or (1,5)-linkages, arabinoxylans and arabinogalactans)

Comments:
-

Primary Sequence


MRTARFTLDPAFTVGAVNPRLFGSFVEHLGRCVYTGVFEPGHPTADAEGLRQDVLELVRELGVTAVRYPG
GNFVSGYKWEDSVGPVEDRPRRLDLAWRSTETNRFGLSEYIAFLKKIGPQAEPMMAVNLGTRGVAEALEL
QEYANHPSGTALSDLRAEHGDKDPFGIRLWCLGNEMDGPWQTGHKTAEEYGRVAAETARAMRQIDPDVEL
VACGSSGQSMETFAEWEATVLKETYDLVDHISLHAYYEPHDGDVDSFLASAVDMESFIENVVATCDHVGA
RLKSKKKINLSFDEWNVWYMTKTQAEVSALDWPEAPRLLEDNYSVMDAVVFGSLLIALLRHADRVTVACL
AQLVNVIAPIMTEPGGPAWRQTTFFPFSQASKYGRGEVLDVRVDSPTYDTAKYGEADLLHATAVRAEDGS
VTVFAVNRSRTGALPLEVALSGLELTEVVEHSALADADPDARNTLAEPERVVPHPVDGTSLRDGRLTAAL
EPLSWNSIRLR