Welcome, please Login here

» α-L-Rhamnosidase

  • GBP
  • USD
  • Euro

Under Development

Catalogue No.:
PRO-E0168

LOT:
2008-0168

Source Organism:
Streptomyces coelicolor A3(2)

Enzyme Properties


  • PDF Downloads
  • Product Specification Sheet
    Download
  • Material Safety Data Sheet
    Download

EC No.:
3.2.1.40

Synonyms:
α-L-rhamnoside rhamnohydrolase; α-L-rhamnosidase T; α-L-rhamnosidase N; alpha-L-rhamnosidase; alpha-L-rhamnoside rhamnohydrolase; alpha-L-rhamnosidase T; alpha-L-rhamnosidase N

Nomenclature:
CAZy [GH78, glycoside hydrolase family 78]

Specific Activity:
-

Accession No.:
CAB53318.1

Molecular Weight:
126278.0 Da

Biological Function:
Catalyses the hydrolysis of terminal non-reducing α-L-rhamnose residues in α-L-rhamnosides

Comments:
-

Primary Sequence


MHRIVKRAVETFQAQRRTHMSEETTEGSTEGSTGESTGNGTEGWNRRVFLRGTVTTAGVAGVTALTGRGA
VAAAGSGTGDGPAKTGTTGTGLRVVRTGVEYTENLLGTDVERPRLSWELAAPGHGARQTAYHVRVTRGSG
GRGPRTRTVWDSGKVASDRSVGIPYGGPALLPRTRYHWQVRVWDAAGRRSRWSETRWWETSLPADGWRAR
WIGAEEPPSPPSLEGASWIWSPGATASDAPEGERRFRATLTLPAGSVVKRAVVSATADDDFTLYVGGQQV
LHAPLQTDGWRTGRTADVTEQARSADGAILVAALATNRPGASVNPGGFLARLLVETEDGRTRELRTGDGW
RTSGTAQEGWERPGFDDGDWEPAAVLAPYGQGPWGGNVTVTGPEAPAPLLRRDFTVHGRVARARLHISGL
AYYEAEINGRRVGDQVLDPGFTDYDETVLYAVHDVTELLRSGENAIGVAVGRGFYGMTTPNVWNWHRAPW
HGEPRLLAQLEIDHPDGTRTTVATDGEWRITEGPTLSNSLYAGETYDARRAPEGWSRAGFDDSGWRSAGV
REAPGGTLRAQPHDPIGIVDTVRPKAVGELRDGVYVVDMGRTMAGWTRLTVRGAAEGTVVRLVHGEKLED
DGSVHAETGHVPGRFQTDEYVCAGRDEEVWEPSFSYKGFRYVEVHGLHARPAPEDVLGRLVHSRVDEVSS
FSCSEPFYEWLDRAMRRTVLNNLHGIPTDTPMYEKNGWTGDAQLGTPVMTYAFGMQRFLSKWLGDLADSQ
NDDGQLPVIVPSGGWGYGDLGPSPEWTTVYPFVVRELYRVYGDERAAREHWETLTRYLDWELGRLRDGLA
VTALGDYLAPGYGGNPPEDTRLTATAYLYRALLHTAELGEALTGLPGDNDVPGRYRAAAEELRKAFNEAF
LGPDGHYRTAKDPDYRQTSNAIPLAFGLVPPGARATVLESLVADIEERGNHLNTGALGTSVLLRVLCAHG
RPDVAHAVATRRTYPGWGYWHDNGADTMWEMWPLDSRSRDHYFQGTVAQWLYENVAGLRPGDAGWRTFTV
RPDARTGVEWARTSIRTVRGEAAVAWSAVDGRLRLTVRVPVGSRAEVHVPVSEGGRATVPRGAEFVRSVP
GFDILRAGHGSWEFTGDA