Welcome, please Login here

» Endo-arabinanase

  • GBP
  • USD
  • Euro

Under Development

Catalogue No.:
PRO-E0170

LOT:
2008-0170

Source Organism:
Streptomyces coelicolor A3(2)

Enzyme Properties


  • PDF Downloads
  • Product Specification Sheet
    Download
  • Material Safety Data Sheet
    Download

EC No.:
3.1.1.99

Synonyms:
Arabinanase; arabinan endo-1,5-α-L-arabinosidase; endo-1,5-α-L-arabinanase; endo-α-1,5-arabanase; endo-arabanase; 1,5-α-L-arabinan 1,5-α-L-arabinanohydrolase; 5-α-L-arabinan 5-α-L-arabinanohydrolase; arabinan endo-1,5-alpha-L-arabinosidase; endo-1,5-alpha-L-arabinanase; endo-alpha-1,5-arabanase; endo-arabanase; 1,5-α-L-arabinan 1,5-α-L-arabinanohydrolase; 5-alpha-L-arabinan 5-alpha-L-arabinanohydrolase

Nomenclature:
CAZy [GH43, glycoside hydrolase family 43, member of clan GH-F]

Specific Activity:
-

Accession No.:
CAC16457.1

Molecular Weight:
37299.3 Da

Biological Function:
Catalyses the endohydrolysis of (1→5)-α-arabinofuranosidic linkages in (1→5)-arabinans

Comments:
-

Primary Sequence


QTALRAADPSVIRVGGTYVSVQSTGGGIAVRQAASTAALAAAPARQVWSDARGRGEVWAPEIVRDGGRYY
IYFSAGRGAAHRMYVISSTAADSGYTAESQLALPDDKWAIDGTLFTFEGQRWFVWSGWAGDTNVEQNLYI
ARMSGPTTPTGARYVISQPRESWERVVGNPFINEGPEPVMDPNGQLHIAYSANGSWSDQYCLADLRLRAG
GDPTYVWDWYKSNGCLFGSHRATMMAGWDPTLYVDGPGHHSFVLLDGDIATSPPAGPRFPLMFHAVAKGT
PYSWENRHWYTGTFCWWGGTTYSRANVPGPTSDTGWSLKFFE