Welcome, please Login here

» β-Galactosidase

  • GBP
  • Euro
  • USD

Under Development

Catalogue No.:
PRO-E0241

LOT:
2008-0241

Source Organism:
Streptomyces coelicolor A3(2)

Enzyme Properties


  • PDF Downloads
  • Material Safety Data Sheet
    Download

EC No.:
3.2.1.23

Synonyms:
Lactase; β-lactosidase; maxilact; hydrolact; β-D-lactosidase; S 2107; lactozym; trilactase; β-D-galactanase; oryzatym; sumiklat; β-D-galactoside galactohydrolase; beta-galactosidase; beta-lactosidase; beta-D-lactosidase; beta-D-galactanase; beta-D-galactoside galactohydrolase

Nomenclature:
CAZy [GH3, glycoside hydrolase family 3]

Specific Activity:
-

Accession No.:
CAB56688.1

Molecular Weight:
81719.2 Da

Biological Function:
Catalyses the hydrolysis of terminal non-reducing β-D-galactose residues in β-D-galactosides

Comments:
-

Primary Sequence


MTLPLYRDPAAPVPDRVRDLLGRMTLAEKVGQVNQRMYGWDAYERAGDGHRLTDAFRAEVAAFDGMGALY
GLQRADAWSGVGFADGLDARDGARTAAAVQRYVMDHTRLGIPVLLVEEMPHGHQALDGTVLPVNLAVGAT
WDPDLYADAVAGAAAELRARGAHIALVSALDLVRDPRWGRSEECFSEDPYLAARMTEALVEGARRAGVAV
VLKHFAGQGATVGGRNSAATELGPRELHEVHLAAARAGVAAGAAGVMAAYNEFDGLPCVANRYLLTDLLR
TEWGFEGVVMADGTAVDRLVRLTGDPVSAGALALDAGCDLSLWDASFTRLGEAVERGLVSESALDAAVAR
VLTLKFRLGLFEQPLPPARSETVELPDPAELGERIARASVTLLAHEGGVLPLSRAVRRIAVLGPNADSVA
QQIGDYTAPQRPGGGITVLEGIRAAVAAGTEVVHDRGCALVGDDVSGVPAAVALAAGSDVAVLVLGGSSA
RSPDTVFDANGAAVTGTGTPSGMTCGEGVDLADLALPPGQRALLTAVSATGTPVVVVLVQGRPHALTELD
APAAAVLSAWYPGPRGGRAVAEVLFGDAEPRGRLPVSVPRSAAQLPVYYNGKDHRYRGYADQSAGPLHAF
GHGLSYTSVVYGAPRLSQARVGTRAPRLTCRVTVRNTGSRPAEETVQLYVRRLSGGSSWPRVRELRGFVR
LTIAPGEEAEAVFEVDRDTLASVGRDLRLAVEPGLVELETGPASDRTTGVRLEITDSESNAT