Welcome, please Login here

» β-Xylosidase

  • GBP
  • Euro
  • USD

Under Development

Catalogue No.:
PRO-E0244

LOT:
2008-0244

Source Organism:
Streptomyces coelicolor A3 (2)

Enzyme Properties


  • PDF Downloads
  • Material Safety Data Sheet
    Download

EC No.:
3.2.1.37

Synonyms:
Xylan 1,4-β-xylosidase; xylobiase; exo-1,4-β-xylosidase; β-D-xylopyranosidase; exo-1,4-xylosidase; exo-1,4-β-D-xylosidase; 1,4-β-D-xylan xylohydrolase; 4-β-D-xylan xylohydrolase; xylan 1,4-beta-xylosidase; exo-1,4-beta-xylosidase; beta-D-xylopyranosidase; exo-1,4-beta-D-xylosidase; 1,4-beta-D-xylan xylohydrolase; 4-beta-D-xylan xylohydrolase

Nomenclature:
CAZy [GH3, glycoside hydrolase family 3]

Specific Activity:
-

Accession No.:
CAB88164.1

Molecular Weight:
85658.6 Da

Biological Function:
Catalyses the hydrolysis of (1→4)-β-D-xylans, to remove successive D-xylose residues from the non-reducing termini

Comments:
This enzyme also hydrolyses xylobiose and xylooligosaccharides

Primary Sequence


MTADVAVETTPEIPLWNDPNHPVATRVDALVAAMTLEEKIAQLYGVWVGASDQGGEVAPHQHDMEEAVDL
DALVPAGLGQLTRPFGTVPVDPALGALSLMRTQARITSAGRFGIPAVAHEECLAGFAAWGATAYPVPLSW
GATFDPDAVRRMAAAIGRDMRSVGIHQGLAPVLDVVRDARWGRVEETIGEDPYLVGTIGTAYVQGLESAG
IVATLKHFVGYSASRAGRNLAPSSVGTRERADVLLPPFEMAVREGGSRSVMSAYTDIDGVPAAADEALLT
GLLRDTWGFEGTVVADYFGIAFLKTLHGITADWADAAGAALKAGLDVELPTVKTFGTPLVDAVTDGRVPE
ALIDRALRRVLGQKAELGLLDPDWSPVPPALDGVDLSHPEALRGRIDLDRPENRELAREIAEKAVVLLTN
DGTLPLARPRRIALIGPNAAEATAVLGCYSFPRHVGVQHPEVPVGLDLPTLYDTLTAEFPDADITLARGT
GVDDGEVSGIGEAVDAARAADVVVAVLGDRAGLFGRGTSGEGCDAESLTLPGAQQRLLDALLDSGTPVVT
VLLAGRPYALGRAIAESAAIVQSFFPGEEGTAALAGVLSGRTSPTGRLPVSVPGSAGAQPTTYLGARLAQ
ASEVSNIDPTPAFGFGHGLTYTTFAWSDLVAHTKEAPTDGAFSLELTVRNTGERHGTEVVQLYLHDPVAS
VVQPVQRLIGYTRVPLAPGEARRVRVEVPADLASFTGRDGRRIVEPGDLELRFAASSTEPRLTATVALTG
PERRVDHTRRLHAVFAQETVEGAVEGA