Welcome, please Login here

» Glucanase

  • GBP
  • USD
  • Euro

Under Development

Catalogue No.:
PRO-E0245

LOT:
2008-0245

Source Organism:
Streptomyces coelicolor A3(2)

Enzyme Properties


  • PDF Downloads
  • Material Safety Data Sheet
    Download

EC No.:
-

Synonyms:
-

Nomenclature:
CAZy [GH16, glycoside hydrolase family 16, member of clan GH-B]

Specific Activity:
-

Accession No.:
CAA19944.1

Molecular Weight:
46164.2 Da

Biological Function:
-

Comments:
-

Primary Sequence


AVPPPPSGWTQVFADDFDGAAGSGVNTANWQYDTGTSYPGGPANWGTGEIETMTSSPSNVSLDGGGNLRI
TPQRDGAGNWTSGRIETKRADFEPPAGGKLRVEARIQVPNVTGAAAKGYWPAFWMLGAPYRGNYWNWPGV
GEIDIMENTQGLNTVWSTLHCGTSPGGPCNETSGIGGNTPCPGATCQAGFHTYRVEWDRSTSVEEIRFSV
DGNNFHTVRANQVDATTWANATNHGYFIILNVAMGGGFPDAFGGGPDGGTQPGHSMLVDYVQVLSAGGSG
TTPPPTGGDRDAYGAIEAESYDAQSGTMTEGTSDSGGGSNLGALANGDWVQYKGVEFGSSAATQFKARVA
SGAAAGVSGLVEVRLDSRTSTPVGSFAVGNTGGWQSWRTIPANIASVTGTHDVYLTFTSGQSADFVNVNW
FGFGH