Welcome, please Login here

» Acetyl xylan esterase

  • GBP
  • USD
  • Euro
  • Catalog #
    Size
    Price
    Qty
     
  • PRO-E0036-40
    40U
    51.00
  • PRO-E0036-120
    120U
    138.00

Catalogue No.:
PRO-E0036

LOT:
2008-0036

Source Organism:
Clostridium thermocellum

Enzyme Properties


  • PDF Downloads
  • Product Specification Sheet
    Download
  • Material Safety Data Sheet
    Download

EC No.:
3.1.1.72

Synonyms:
Acetylxylan esterase

Nomenclature:
CAZy [CE4, carbohydrate esterase family 4], 4A

Specific Activity:
10 U/mg

Accession No.:
ABN54169

Molecular Weight:
24000 Da

Biological Function:
Deacetylation of xylans and xylo-oligosaccharides

Comments:
Also catalyses the hydrolysis of acetyl groups from acetylated xylose, acetylated glucose, α-napthyl acetate, and p-nitrophenyl acetate

Primary Sequence


MPNAKLVALTFDDGPDNVLTARVLDKLDKYNVKATFMVVGQRVNDSTAAIIRRMVNSGHEIGNHSWSYSG
MANMSPDQIRKSIADTNAVIQKYAGTTPKFFRAPNLETSPTLFNNVDLVFVGGLTANDWIPSTTAEQRAG
AVINGVRDGTIILLHDVQPEPHPTPEALDIIIPTLKSRGYEFVTLTELFTLKGVPIDPSVKRMYNSVP