Welcome, please Login here

» Carbohydrate binding module

  • GBP
  • USD
  • Euro
  • Catalog #
    Size
    Price
    Qty
     
  • PRO-E0039-0.4
    0.4mg
    51.00
  • PRO-E0039-1.2
    1.2mg
    138.00

Catalogue No.:
PRO-E0039

LOT:
2008-0039

Source Organism:
Clostridium thermocellum

Enzyme Properties


  • PDF Downloads
  • Product Specification Sheet
    Download
  • Material Safety Data Sheet
    Download

EC No.:
N/A

Synonyms:
CBM; CBD; carbohydrate binding domain

Nomenclature:
CAZy [CBM22, carbohydrate binding module family 22], CtCBM22A is a family 22 β-1,4-glucan-binding module

Specific Activity:
N/A

Accession No.:
CAA58242

Molecular Weight:
19204.2 Da

Biological Function:
Binds to β-1,4-glucans

Comments:
CtCBM22A binds to both decorated (wheat arabinoxylan Ka 8 104 M-1 and rye arabinoxylan Ka 1.1 105 M-1) and less decorated (oat spelt xylan Ka 7.6 104 M-1) xylans. CtCBM22A also binds to barley β-glucan (Ka 7.8 102 M-1)

Primary Sequence


MKPEEPDANGYYYHDTFEGSVGQWTARGPAEVLLSGRTAYKGSESLLVRNRTAAWNGAQRALNPRTFVPG
NTYCFSVVASFIEGASSTTFCMKLQYVDGSGTQRYDTIDMKTVGPNQWVHLYNPQYRIPSDATDMYVYVE
TADDTINFYIDEAIGAVAGTVIEG