Welcome, please Login here

» Endo-1,4-β-xylanase

  • GBP
  • USD
  • Euro

Under Development

Catalogue No.:
PRO-E0301

LOT:
2008-0301

Source Organism:
Opitutus terrae PB90-1

Enzyme Properties


  • PDF Downloads
  • Product Specification Sheet
    Download
  • Material Safety Data Sheet
    Download

EC No.:
3.2.1.8

Synonyms:
Endo-(1→4)-β-xylan 4-xylanohydrolase; endo-1,4-xylanase; xylanase; β-1,4-xylanase; endo-1,4-xylanase; endo-β-1,4-xylanase; endo-1,4-β-D-xylanase; 1,4-β-xylan xylanohydrolase; β-xylanase; β-1,4-xylan xylanohydrolase; endo-1,4-β-xylanase; β-D-xylanase; 4-β-D-xylan xylanohydrolase; endo-(1→4)-beta-xylan 4-xylanohydrolase; beta-1,4-xylanase; endo-beta-1,4-xylanase; endo-1,4-beta-D-xylanase; 1,4-beta-xylan xylanohydrolase; beta-xylanase; beta-1,4-xylan xylanohydrolase; endo-1,4-beta-xylanase; beta-D-xylanase; 4-beta-D-xylan xylanohydrolase

Nomenclature:
CAZy [GH8, glycoside hydrolase family 8, member of clan GH-M]

Specific Activity:
-

Accession No.:
ACB77586

Molecular Weight:
48642.8

Biological Function:
Catalyses the endohydrolysis of (1→4)-β-D-xylosidic linkages in xylans

Comments:
-

Primary Sequence


MRFPFLPLVLGLALGSLSAVAATAAQGAAETGRYRNPFKELLGKSDAEINAKLQAAWQQLFYGDENSQRL
FYPIAGDMAYVPDINNNDVRSEGLSYGMMIAVQMDRQKEFNQIWKFAKHYMYYDAGPFRGYFAWHTAFDG
RRLSPGPAPDGEEWWVMALFFASHRWGDGEGIFNYRKEAQDLLRTMLHKNEEPDRGPITAMFDPVHKQIV
FVPQGPGAQFTDPSYHLPAYYELWARWAADPADRAFMAEAAKISREHFRTAAHPKTGLMPDYSNFDGTPY
TARWGNHQDFLYDAWRTLNNPALDYSWWAADPWVVEQSNRVLTFLSSFGSEVPDRFKLDGTPVSTDTNTA
GLTAMAACAGLAADSVIAKPWVQQLWDMPIPTGRHRYYGGLLTMIALLECSGNFKIYGPVAK