Welcome, please Login here

» β-Xylosidase

  • GBP
  • USD
  • Euro

Under Development

Catalogue No.:
PRO-E0310

LOT:
2008-310

Source Organism:
Opitutus terrae PB90-1

Enzyme Properties


  • PDF Downloads
  • Product Specification Sheet
    Download
  • Material Safety Data Sheet
    Download

EC No.:
3.2.1.37

Synonyms:
Xylan 1,4-β-xylosidase; xylobiase; exo-1,4-β-xylosidase; β-D-xylopyranosidase; exo-1,4-xylosidase; exo-1,4-β-D-xylosidase; 1,4-β-D-xylan xylohydrolase; 4-β-D-xylan xylohydrolase; xylan 1,4-beta-xylosidase; exo-1,4-beta-xylosidase; beta-D-xylopyranosidase; exo-1,4-beta-D-xylosidase; 1,4-beta-D-xylan xylohydrolase; 4-beta-D-xylan xylohydrolase

Nomenclature:
CAZy [GH39, glycoside hydrolase family 39, member of clan GH-A]

Specific Activity:
-

Accession No.:
ACB74647

Molecular Weight:
63755.7 Da

Biological Function:
Catalyses the hydrolysis of (1→4)-β-D-xylans, to remove successive D-xylose residues from the non-reducing termini

Comments:
This enzyme also hydrolyses xylobiose and xylooligosaccharides

Primary Sequence


MKRLLSLFSAVCFASPLFAADAPFPVSVTVDAAHSLGPLKPVWRFFGADEPNYTTMKDGRRLLGELGTLR
PGEVYFRTHNLLTSGDGTPAHKWGSTNAYTEDAAGRPVYDWTIVDRIFSTGLARGVRPYVEIGFMPQALS
THPEPYQHEWRAGLPYERIYTGWAYPPKDFEKWGELVYQWAKHCVEEFGAAEVERWYWETWNEANIPYWQ
GTPEEFIKLHDYAIAAVRRALPTARVGGPDFAGHGGPRMHEFLEHCLRGKNHATGETGTPLDFISFHAKG
SPAFVDGHIRMGIAPHLRTLDEGFAIVASYPELKAKPIVIGESDPEGCAACMGGQFTYRSGTVYSSYTAA
SFARKYDLAAKHGVNLEGVLTWAFEFEDQPYFAGQRVLSSNGIALPVLNVFRMFSRLGTERVAAESSGAI
PLDDILRQGVRRAPDVGAFASRDAHQVAVVLWHYHDDDVAGPDAAVEFAVRGLPDTLRTARVSHARIDAT
HSNAFAEWKRMGTPLAPNQQQYDALQRASQLAQLAESPASVAVESGVATLHFALPRQAVSLVVLEWE