Welcome, please Login here

» β-Xylosidase

  • GBP
  • USD
  • Euro
  • Catalog #
    Size
    Price
    Qty
     
  • PRO-E0319-31.35 U
    31.35 U
    10.00
  • PRO-E0319-1 mg
    1 mg
    10.00
  • PRO-E0319-313.5 U
    313.5 U
    70.00
  • PRO-E0319-10 mg
    10 mg
    70.00
  • PRO-E0319-3135 U
    3135 U
    450.00
  • PRO-E0319-100 mg
    100 mg
    450.00
  • PRO-E0319-31350 U
    31350 U
    2,500.00
  • PRO-E0319-1 g
    1 g
    2,500.00

Catalogue No.:
PRO-E0319

LOT:
2011-0319-1

Source Organism:
Opitutus terrae PB90-1

Enzyme Properties


  • PDF Downloads
  • Product Specification Sheet
    Download
  • Material Safety Data Sheet
    Download

EC No.:
3.2.1.37

Synonyms:
Xylan 1,4-β-xylosidase; xylobiase; exo-1,4-β-xylosidase; β-D-xylopyranosidase; exo-1,4-xylosidase; exo-1,4-β-D-xylosidase; 1,4-β-D-xylan xylohydrolase; 4-β-D-xylan xylohydrolase; xylan 1,4-beta-xylosidase; exo-1,4-beta-xylosidase; beta-D-xylopyranosidase; exo-1,4-beta-D-xylosidase; 1,4-beta-D-xylan xylohydrolase; 4-beta-D-xylan xylohydrolase

Nomenclature:
CAZy [GH52, glycoside hydrolase family 52]

Specific Activity:
31.35 U/mg

Accession No.:
B1ZP95, YP_001821184, ACB77584

Molecular Weight:
81101.4 Da

Biological Function:
Catalyses the hydrolysis of (1→4)-β-D-xylans, to remove successive D-xylose residues from the non-reducing termini

Comments:
This enzyme also hydrolyses xylobiose and xylooligosaccharides

Primary Sequence


MAQESYHTQHAPFGAFASFTVGLVDSQGGFGQSLGVPARQNVYVGFRSAQHARWQMLPFLNPPVAAETAF
TAEDTVPRPPGGFDALRPAAYQRTLNWASDTWRADESRFGFSLLTPFDHVADPAKMKKSAARFQLAPAIF
GWIEYDNRAGTEPVELMFGIGDPSRPLRPLSEADPKLVGFAGGTGWGYATAPTRGIELRQGFDVFAPKFR
DYHGLLVIAAETALVFSVPAGRRKRFPLVLGFYAAGTQTTGLPASYAYTRVFDDLEDVLKHGLEHFDRYA
AIAATRDRELDRSRLNPDQRFLLAQSTHSYYGSTQLLWDKRGPLWMVNEGEYRMINTFDLTVDHVFFELA
WHPWAVRDVLDLFVRRYSYRDRHGLAFTHDMGVMNHFTMPGRSSYECDHLTGCFSHMTMEQLLNWVLTAV
TYASHTEDRRWLKTNLKTLLACAESLHVRDDADPKKRDGILKRDSDRCGADGSEITTYDSLDVSLGQARN
NLYLAVKTLGAWVLLERAFGALGQAKAAGDARATADRLAQSITQKFEHDTGFFPAVFEKGNRSRILPAVE
GFIYPLYLGYTDATNRTGRFAPLFRQLGQHMAQALQPGICLDAKSGGWKMSSTSTNTWFSKIAIAQHVVR
QLFPEVMNDAARAGDRVHADWQRTPGCGRDAMCDQIRSDSGVACGSRYYPRGVSCYLWLSE