Welcome, please Login here

» α-Glucuronidase

  • GBP
  • Euro
  • USD

Your currency for this session has been set to Euro.

  • Catalog #
    Size
    Price
    Qty
     
  • PRO-E0321-1 mg
    1 mg
    11.90
  • PRO-E0321-21.12 U
    21.12 U
    11.90
  • PRO-E0321-10 mg
    10 mg
    83.30
  • PRO-E0321-211.2 U
    211.2 U
    83.30
  • PRO-E0321-100 mg
    100 mg
    535.50
  • PRO-E0321-2112 U
    2112 U
    535.50
  • PRO-E0321-1 g
    1 g
    2,261.00
  • PRO-E0321-21 KU
    21 KU
    2,261.00

Catalogue No.:
PRO-E0321

LOT:
2012-0321-1

Source Organism:
Opitutus terrae PB90-1

Enzyme Properties


  • PDF Downloads
  • Product Specification Sheet
    Download
  • Material Safety Data Sheet
    Download

EC No.:
3.2.1.139

Synonyms:
α-Glucosiduronase; α-D-glucosiduronate glucuronohydrolase; alpha-glucuronidase; alpha-glucosiduronase; alpha-D-glucosiduronate glucuronohydrolase

Nomenclature:
CAZy [GH67, glycoside hydrolase family 67]

Specific Activity:
21.12 U/mg

Accession No.:
ACB77588

Molecular Weight:
82809.8 Da

Biological Function:
Catalyses the following reaction: α-D-glucuronoside + H(2)O = an alcohol + D-glucuronate

Comments:
-

Primary Sequence


MRLPFVSIAAMAVALAAGSLLRADDGYRLWLRYDRVADESLRATYAAAFTEIALPAPTRPGFSLGSIEAA
RDELTTGLKGLLGVDLSTVSQPTRDGALLLGTAVRSPELAGLVSEADLRAASEEGYVIRPVIFAGKRCVL
VLGNRDVGVLYGAFALLRHVQLHEPIAGLNLVSAPRIQRRLLNHWDNLNGFVERGYAGQSLWRWFELPDI
VSPRYRDYARACASIGVNGTVLTNVNANALVLTPAYLQKVAALANVFRPYGIRVYLTARFSAPVEIGGLK
TADPLDPAVKQWWTDKVAEIYRIIPGFGGFLVKANSEGQPGPQAYGRNHADGANMLADALVPYGGIVMWR
AFVYDNNVPADRHTQGFSEFQPLDGQFRSNAIVQVKNGAIDFMPREPFHPLFGAMPQTPLALELQITQEY
LGQSMQLAFLGPLFEEVLDADTFRPNAGSTIAKIVDGSVDLHGISVIAGVANIGDDRNWTGHPLAQANWY
AYGRLAWDHQLTSAQIANEWTRLTFGNDSAVVQPITSMLLESHEAVVNYSMPLGLHHIMAEGHHYGPGPW
VDQAGRADWTSVYYHRADANGVGFDRTKSGSNALAQYAPEIQNLWGNPATTPDNLLLWFHHLPWDYRMKS
GRPLWDEIALHYQSGVDTVRTWQKAWATLNGKMDDERFTHVKQLLARQEHDARVWRDACLLYFQQFSKKP
LPAGVEPPEHPLDFYKAQQIHFAPGHPGAH