Welcome, please Login here

» Carbohydrate binding module

  • GBP
  • Euro
  • USD
  • Catalog #
    Size
    Price
    Qty
     
  • PRO-E0047-3
    3mg
    51.00
  • PRO-E0047-9
    9mg
    138.00

Catalogue No.:
PRO-E0047

LOT:
2008-0047

Source Organism:
Clostridium thermocellum

Enzyme Properties


  • PDF Downloads
  • Product Specification Sheet
    Download
  • Material Safety Data Sheet
    Download

EC No.:
N/A

Synonyms:
CBM; CBD; carbohydrate binding domain

Nomenclature:
CAZy [CBM6, carbohydrate binding module family 6], CtM6 is a family 6 galactose side-chain carbohydrate binding module

Specific Activity:
N/A

Accession No.:
ABN53395

Molecular Weight:
16710.3 Da

Biological Function:
Anchoring of modular enzyme to target polysaccharide

Comments:
Binds to the galactose side-chains of xyloglucan and galactomannan

Primary Sequence


MYPKLTGTVIGTQGSWNNIGNTIHKAFDGDLNTFFDGPTANGCWLGLDFGEGVRNVITQIKFCPRSGYEQ
RMIGGIFQGANKEDFSDAVTLFTITSLPGSGTLTSVDVDNPTGFRYVRYLSPDGSNGNIAELQFFGTPAG
EENDD