Welcome, please Login here

» Pectate lyase

  • GBP
  • Euro
  • USD
  • Catalog #
    Size
    Price
    Qty
     
  • PRO-E0251-283
    283U
    10.00
  • PRO-E0251-1
    1mg
    10.00
  • PRO-E0251-2830
    2830U
    70.00
  • PRO-E0251-10
    10mg
    70.00
  • PRO-E0251-28300
    28300U
    450.00
  • PRO-E0251-100
    100mg
    450.00

Catalogue No.:
PRO-E0251

LOT:
2008-0251

Source Organism:
Caulobacter crescentus CB15

Enzyme Properties


  • PDF Downloads
  • Product Specification Sheet
    Download
  • Material Safety Data Sheet
    Download

EC No.:
4.2.2.2

Synonyms:
Polygalacturonic transeliminase; pectic acid transeliminase; polygalacturonate lyase; endopectin methyltranseliminase; pectate transeliminase; endogalacturonate transeliminase; pectic acid lyase; pectic lyase; α-1,4-D-endopolygalacturonic acid lyase; PGA lyase; PPase-N; endo-α-1,4-polygalacturonic acid lyase; polygalacturonic acid lyase; pectin trans-eliminase; polygalacturonic acid trans-eliminase; (1→4)-α-D-galacturonan lyase; alpha-1,4-D-endopolygalacturonic acid lyase; endo-alpha-1,4-polygalacturonic acid lyase; (1→4)-alpha-D-galacturonan lyase

Nomenclature:
CAZy [PL10, polysaccharide lyase family 10], Pel10A

Specific Activity:
283 U/mg

Accession No.:
Q9A6P9

Molecular Weight:
58857.2 Da

Biological Function:
Catalyses the eliminative cleavage of (1→4)-α-D-galacturonan to give oligosaccharides with 4-deoxy-α-D-galact-4-enuronosyl groups at their non-reducing ends

Comments:
Note: shows a preference for 31 % esterified pectin over polygalacturonic acid

Primary Sequence


APTRDAALETMKKATRFMVDKVAYKGGYVWSYLPDLSRRWGEMEAYPTMIWVQPPGTATMGHVFLDAYHA
TGDEAYYDAACKAAEALIAIQHPAGGWNYLGDLAGEASIRKWYDTIGKNGWRLEEFQHYYGNATFDDAGT
AESSQFLLRLYVEKQDKRFKPALDKALQFVVDSQYPNGGWPQRFPLKTEFQNHGRPDYTGYITFNDDVAG
ENIKFLIMIWQTLGDPRALPAIKKAMDCFVICQQPQPQPAWGLQHHVDTLKPAAARSYEPEAFASHTTGA
NIASCMDFYQLTGDPKYLARLGEALDWLDSIRLPQEIQKGRPYPTFIEVGTGKPLYVHRRGSNVVNGEYY
TDENPHGTVIHYSSFRAVNVDGLRKRLAKLKAMSPEVASKDSPLKGGRKALPKYFTTGDISVSDLNVDTL
KADAGQTSPDKVASLIASLNAEGWWPTELRATSNPYIGDGSPTPAPGDFSQTRVGDATDTSPYITDTPKI
GISTGTYIENMAALIKYVTAS