Welcome, please Login here

» β-Mannosidase

  • GBP
  • USD
  • Euro
  • Catalog #
    Size
    Price
    Qty
     
  • PRO-E0052-10.6
    10.6U
    10.00
  • PRO-E0052-1
    1mg
    10.00
  • PRO-E0052-106
    106U
    70.00
  • PRO-E0052-10
    10mg
    70.00
  • PRO-E0052-1062
    1062U
    450.00
  • PRO-E0052-100
    100mg
    450.00

Catalogue No.:
PRO-E0052

LOT:
2008-0052

Source Organism:
Bacteroides thetaiotaomicron VPI-5482

Enzyme Properties


  • PDF Downloads
  • Product Specification Sheet
    Download
  • Material Safety Data Sheet
    Download

EC No.:
3.2.1.25

Synonyms:
Mannanase; mannase; β-D-mannosidase; β-mannoside mannohydrolase; exo-β-D-mannanase; β-D-mannoside mannohydrolase; beta-mannosidase; beta-D-mannosidase; beta-mannoside mannohydrolase; exo-beta-D-mannanase; beta-D-mannoside mannohydrolase

Nomenclature:
CAZy [GH2, glycoside hydrolase family 2, member of clan GH-A], Bt0458, BtMan2A, mannosidase 2A, Man2A

Specific Activity:
10.62 U/mg (pH 5.6, 5 mg/mL ivory nut mannan)

Accession No.:
Q8AAK6; AE015928; BTHE226186:BT_0458-MON

Molecular Weight:
96040.16 Da

Biological Function:
Catalyses the hydrolysis of terminal, non-reducing β-D-mannose residues in β-D-mannosides

Comments:
PDB: 2JE8, 2VJX, 2VL4, 2VMF, 2VO5, 2VOT, 2VQT, 2VQU, 2VR4. Note: different to β-mannanase (EC 3.2.1.78)

Primary Sequence


QGNDTSEVMLLDTGWEFSQSGTEKWMPATVPGTVHQDLISHELLPNPFYGMNEKKIQWVENEDWEYRTSF
IVSEEQLNRDGIQLIFEGLDTYADVYLNGSLLLKADNMFVGYTLPVKSVLRKGENHLYIYFHSPIRQTLP
QYASNGFNYPADNDHHEKHLSVFSRKAPYSYGWDWGIRMVTSGVWRPVTLRFYDIATISDYYVRQLSLTD
ENARLSNELIVNQIVPQKIPAEVRVNVSLNGTTVTEVKQQVTLQPGINHITLPAEVTNPVRWMPNGWGTP
TLYDFSAQIACGDRIVAEQSHRIGLRTIRVVNEKDKDGESFYFEVNGIPMFAKGANYIPQDALLPNVTTE
RYQTLFRDMKEANMNMVRIWGGGTYENNLFYDLADENGILVWQDFMFACTPYPSDPTFLKRVEAEAVYNI
RRLRNHASLAMWCGNNEILEALKYWGFEKKFTPEVYQGLMHGYDKLFRELLPSTVKEFDSDRFYVHSSPY
LANWGRPESWGTGDSHNWGVWYGKKPFESLDTDLPRFMSEFGFQSFPEMKTIAAFAAPEDYQIESEVMNA
HQKSSIGNSLIRTYMERDYIIPESFEDFVYVGLVLQGQGMRHGLEAHRRNRPYCMGTLYWQLNDSWPVVS
WSSIDYYGNWKALHYQAKRAFAPVLINPIQQNDSLSVYLISDRLDTMEQMTLEMKVVDFDGKTLGKKIQV
HSLEVPANTSKCVYRAKLDGWLTPEDCRRSFLKLILKDKSGHQVAESVHFFRKTKDLQLPPTSVSYQMKQ
TDGKCELTLFSSMLAKDIFIETPLQGARYSDNFFDLLPGERKK