Welcome, please Login here

» β-Mannanase

  • GBP
  • USD
  • Euro
  • Catalog #
    Size
    Price
    Qty
     
  • PRO-E0056-1 mg
    1 mg
    10.00
  • PRO-E0056-10 mg
    10 mg
    70.00
  • PRO-E0056-100 mg
    100 mg
    450.00
  • PRO-E0056-1 g
    1 g
    2,700.00

Catalogue No.:
PRO-E0056

LOT:
2008-0056

Source Organism:
Cellvibrio japonicus NCIMB 10462

Enzyme Properties


  • PDF Downloads
  • Product Specification Sheet
    Download
  • Material Safety Data Sheet
    Download

EC No.:
3.2.1.-

Synonyms:
Mannan endo-1,4-β-mannosidase; endo-1,4-β-mannanase; endo-β-1,4-mannase; β-mannanase B; β-1, 4-mannan 4-mannanohydrolase; endo-β-mannanase; β-D-mannanase; 1,4-β-D-mannan mannanohydrolase; beta-mannanase; mannan endo-1,4-beta-mannosidase; endo-1,4-beta-mannanase; endo-beta-1,4-mannase; beta-mannanase B; beta-1, 4-mannan 4-mannanohydrolase; endo-beta-mannanase; beta-D-mannanase; 1,4-beta-D-mannan mannanohydrolase

Nomenclature:
CAZy [GH26, glycoside hydrolase family 26, member of clan GH-A], CjMan26C, CJA_0236, mannobiose-producing exo-β-mannanase

Specific Activity:
NOTE: this product has been produced and is awaiting assay. It is thus currently available for purchase by the mg only

Accession No.:
ACE84009.1, B3PGI1

Molecular Weight:
45340.5 Da

Biological Function:
This exo-acting enzyme releases mannobiose from the non-reducing end of undecorated β-1,4-mannans

Comments:
PDB: 2VX4, 2VX5, 2VX6, 2VX7

Primary Sequence


MSEKPAESAAAVADSATTTAPQSGKPETALPALIDTQATAETRALYRNLAKLRYKHLLFGHEDSLAYGVH
WEGDMDRSDVRDVTGANPAVYGWELGGLELGHTANLDAVNFEKMQHWIKAGYSRGGVITISWHVFNPVSG
GNSWDKTPAVHELIPGGARHATLKAYLDTFVAFNEGLADVDAQGNKHYPPIIFRPWHEHNGDWFWWGKGH
ASEQDYIALWRFTVHYLRDEKKLRNLIYAYSPDRSRIDMANFEAGYLYGYPGDAYVDIIGLDNYWDVGHE
ANTASADEQKAALTASLKQLVQIARSKGKIAALTATGNNRLTIDNFWTERLLGPISADADASEIAYVMVW
RNANLAREKSEQFFAPFPGQATADDFKRFYQSEVVLFEDELPPLYR