Welcome, please Login here

» α-L-Arabinofuranosidase

  • GBP
  • USD
  • Euro
  • Catalog #
    Size
    Price
    Qty
     
  • PRO-E0057-4.9 U
    4.9 U
    10.00
  • PRO-E0057-2 mg
    2 mg
    10.00
  • PRO-E0057-49 U
    49 U
    70.00
  • PRO-E0057-20 mg
    20 mg
    70.00
  • PRO-E0057-490 U
    490 U
    450.00
  • PRO-E0057-200 mg
    200 mg
    450.00
  • PRO-E0057-4900 U
    4900 U
    1,950.00
  • PRO-E0057-2 g
    2 g
    1,950.00

Catalogue No.:
PRO-E0057

LOT:
2011-0057-1

Source Organism:
Cellvibrio japonicus NCIMB 10462

Enzyme Properties


  • PDF Downloads
  • Product Specification Sheet
    Download
  • Material Safety Data Sheet
    Download

EC No.:
3.2.1.55

Synonyms:
α-N-arabinofuranosidase; arabinosidase; α-arabinosidase; α-L-arabinosidase; α-arabinofuranosidase;polysaccharide α-L-arabinofuranosidase; α-L-arabinofuranoside hydrolase; L-arabinosidase; α-L-arabinanase; α-L-arabinofuranoside arabinofuranohydrolase; alpha-N-arabinofuranosidase; alpha-arabinosidase; alpha-L-arabinosidase; alpha-arabinofuranosidase;polysaccharide alpha-L-arabinofuranosidase; alpha-L-arabinofuranoside hydrolase; alpha-L-arabinanase; alpha-L-arabinofuranoside arabinofuranohydrolase

Nomenclature:
CAZy [GH51, glycoside hydrolase family 51, member of clan GH-A], arabinofuranosidase 51A, CjAbf51A, Abf51A, abf51A

Specific Activity:
2.45 U/mg (pH 5.5; 3.29 mg/mL sugar beet arabinan)

Accession No.:
Q93LE0, AY043167

Molecular Weight:
57640.0 Da

Biological Function:
Hydrolysis of terminal non-reducing α-L-arabinofuranoside residues in α-L-arabinosides (acts on α-L-arabinofuranosides, α-L-arabinans containing (1,2)-, (1,3)- and/or (1,5)-linkages. This enzyme displays a marked preference (~ 300-fold) for the hydrolysis of (1,2)- and (1,3)- linkages over (1,5)-glycosidic bonds

Comments:
-

Primary Sequence


MNTHITIDTTKSGPVINKNIYGQFAEHLGRGIYEGLWVGPESGIPNTRGWRNDVVGALKDINVPLVRWPG
GCFADEYHWRDGIGPRDQRPVKVNTNWGGVEEDNAVGTHEFFDLVEILGAEAYVNGNLGTGTPQEMAEWL
EYMTAEGKSTLAELRRKNGRDKPFQVQYFAIGNEAWGCGGNMTPEYYTNLYNHYATFLKAPAHNAPKLIA
SGGHTEDTSWAAHLTANVKPNWSLKMDAVSFHYYTLPTGKWDKKGAAIGFPEAEWMSTLVNTLRMDDFIV
NNKKVMDKNDPEKKVGFYVDEWGTWYDVEAGENPGFLYQQNSLRDAVVAALNFNIFHKHADRVHMTNIAQ
MVNVLQAMILTDKEKMILTPTYYAYKMYVPFQDATSLPVSLKKVSQYRLGKSSVPAISASAARGKDGKVY
LALVNANPNQAETVALALPGVTASGVSGQLLTATAMDAHNTFANPNAIKPVSYSAKAVNGKLSLELPAKS
VVVVAVE