Welcome, please Login here

» Endo-1,4-β-galactanase

  • GBP
  • Euro
  • USD
  • Catalog #
    Size
    Price
    Qty
     
  • PRO-E0059-192.8 U
    192.8 U
    10.00
  • PRO-E0059-1 mg
    1 mg
    10.00
  • PRO-E0059-1928 U
    1928 U
    70.00
  • PRO-E0059-10 mg
    10 mg
    70.00
  • PRO-E0059-19.3 KU
    19.3 KU
    450.00
  • PRO-E0059-100 mg
    100 mg
    450.00
  • PRO-E0059-193 KU
    193 KUmg
    1,850.00
  • PRO-E0059-1 g
    1 g
    1,850.00

Catalogue No.:
PRO-E0059

LOT:
2009-0059-1

Source Organism:
Cellvibrio japonicus NCIMB 10462

Enzyme Properties


  • PDF Downloads
  • Product Specification Sheet
    Download
  • Material Safety Data Sheet
    Download

EC No.:
3.2.1.89

Synonyms:
Galactanase; arabinogalactanase; arabinogalactan 4-β-D-galactanohydrolase; endo-1,4-beta-galactanase; arabinogalactan 4-beta-D-galactanohydrolase

Nomenclature:
CAZy [GH53, glycoside hydrolase family 53, member of clan GH-A], GalA, galA, ganA

Specific Activity:
192.8 U/mg (2.25 mg/mL potato galactan, pH 7.5)

Accession No.:
P48841, CAA62990.1, X91885

Molecular Weight:
57776.5 Da

Biological Function:
Catalyses the endohydrolysis of (1→4)-β-D-galactosidic linkages in arabinogalactans

Comments:
-

Primary Sequence


MDNTPFYVGADLSYVNEMESCGATYRDQGKKVDPFQLFADKGADLVRVRLWHNATWTKYSDLKDVSKTLK
RAKNAGMKTLLDFHYSDTWTDPEKQFIPKAWAHITDTKELAKALYDYTTDTLASLDQQQLLPNLVQVGNE
TNIEILQAEDTLVHGIPNWQRNATLLNSGVNAVRDYSKKTGKPIQVVLHIAQPENALWWFKQAKENGVID
YDVIGLSYYPQWSEYSLPQLPDAIAELQNTYHKPVMIVETAYPWTLHNFDQAGNVLGEKAVQPEFPASPR
GQLTYLLTLTQLVKSAGGMGVIYWEPAWVSTRCRTLWGKGSHWENASFFDATRKNNALPAFLFFKADYQA
SAQAE