Welcome, please Login here

» α-Galactosidase

  • GBP
  • USD
  • Euro
  • Catalog #
    Size
    Price
    Qty
     
  • PRO-E0063-186.7
    186.7U
    10.00
  • PRO-E0063-1
    1mg
    10.00
  • PRO-E0063-1867
    1867U
    70.00
  • PRO-E0063-10
    10mg
    70.00
  • PRO-E0063-18666
    18666U
    450.00
  • PRO-E0063-100
    100mg
    450.00

Catalogue No.:
PRO-E0063

LOT:
2010-0063

Source Organism:
Clostridium cellulolyticum H10

Enzyme Properties


  • PDF Downloads
  • Product Specification Sheet
    Download
  • Material Safety Data Sheet
    Download

EC No.:
3.2.1.22

Synonyms:
Melibiase; α-D-galactosidase; α-galactosidase A; α-galactoside galactohydrolase; α-D-galactoside galactohydrolase; alpha-galactosidase; alpha-D-galactosidase; alpha-galactosidase A; alpha-galactoside galactohydrolase; alpha-D-galactoside galactohydrolase

Nomenclature:
CAZy [GH27, glycoside hydrolase family 27, member of clan GH-D], Gal27A, gal27A, Ccel_1237

Specific Activity:
186.7 U/mg

Accession No.:
Q0PRN2, DQ778333, ACL75593.1, ABG76969.1

Molecular Weight:
64179.5 Da

Biological Function:
Hydrolysis of terminal, non-reducing α-D-galactose residues in α-D-galactosides, including galactose oligosaccharides and galactomannans

Comments:
No detectable activity against pNP-β-D-glucopyranoside or pNP-β-D-xylopyranoside. This enzyme exhibits strong inhibition by Tris/HCl buffer

Primary Sequence


WDNGLAKTPPMGWNSWNIFHGDINETKIKQIADTMVSSGMKEAGYVYLNLDDNWMANPARDSNGNLRADP
TRFPSGIRALADYVHAKGLKLGIYGCRGTMTCMNIPQSGSKGYEDKDAKTFASWGIDYLKYDNCNIPNGS
DMKTDYQKMQTALANCGRPIVFSICAWGYQSWMPATGNLWRTTGDIADKWDNGNEWFKGIINAIDGNAQY
TSSAAPGAWNDPDMLEIGNGGCTTEEYRTQMSMWSMMASPLIAGNDIRTMSQTTKDILLNKEVIAIDQDP
AGVQGKRVKSANGLEIWVKPLGTNGTTKAVALLNRNSATSNITVNWSDIGVSGSVTVRDLWAKSDKGSFT
GSYTASVPSHGTVLIKISTEPPAPVDATKQIEAESYSNQSGIQTETCSEGGEDVGFIENGDYTVYSNVDF
GDGVGGFQARVASATSGGNIEIRLDSPAGTLIGTCPVAGTGDWQTYTDVKCTVSGATGKHDVYLVFKGDS
GYLFNLNWFTFTPGSVNTGTLGDLNSDGQVDAIDLQLLKKYILGLGAIENTKLADLDANGDINAIDFSLL
KQFLLGIRTSFPGQGAA