Welcome, please Login here

» β-Mannosidase

  • GBP
  • USD
  • Euro
  • Catalog #
    Size
    Price
    Qty
     
  • PRO-E0060-1 mg
    1 mg
    £10.00
  • PRO-E0060-10 mg
    10 mg
    £70.00
  • PRO-E0060-100 mg
    100 mg
    £450.00
  • PRO-E0060-1 g
    1 g
    £2,700.00

Catalogue No.:
PRO-E0060

LOT:
2008-0060

Source Organism:
Cellvibrio japonicus NCIMB 10462

Enzyme Properties


  • PDF Downloads
  • Product Specification Sheet
    Download
  • Material Safety Data Sheet
    Download

EC No.:
3.2.1.25

Synonyms:
Mannanase; mannase; β-D-mannosidase; β-mannoside mannohydrolase; exo-β-D-mannanase; β-D-mannoside mannohydrolase; beta-mannosidase; beta-D-mannosidase; beta-mannoside mannohydrolase; exo-beta-D-mannanase; beta-D-mannoside mannohydrolase

Nomenclature:
CAZy [GH5, glycoside hydrolase family 5, member of clan GH-A], CjMan5D, CJA_0244, man5D

Specific Activity:
-

Accession No.:
B3PGI9, ACE83583.1, YP_001980768.1

Molecular Weight:
48581.4 Da

Biological Function:
Catalyses the hydrolysis of terminal, non-reducing β-D-mannose residues in β-D-mannosides

Comments:
This enzyme is a homologue of CmMan5A (Man5A from Cellvibrio mixtus) that has been shown to be an exo-acting mannanase that releases mannose from the non-reducing end of polymeric substrates (see Ref. 2 in product specification sheet). CjMan5D is thought to be located on the host bacterial cellís outer membrane, and is implicated in the hydrolysis of manno-oligosaccharides (see Ref. 3 in product specification sheet). Note: different to β-mannanase (EC 3.2.1.78)

Primary Sequence


MAPEKMPSPDTSTAKSDTQGAEFVRVQGRQFVLDGKAYYPVGVNFWFGAYLGAEGEQGDRTRLLKELDLL
HSLGVNNLRVLAVSEDSELVRAVRPAIVNAKGEFNESLLQGLDFLLAEMAKRNMTAVLYLNNFWQWSGGM
SQYVAWHKGTPVLDPDVTGEWNAFMQNSAEFYRIADAQVRYHQVIKTLTGRVNSITGIAYHQDPTIMSWQ
LANEPRPGSDADGRPNVEVYIQWIKTTARLLHQLAPQQLVSTGSEGVMGSIGDPAVYVAAHELPEVDYLT
FHMWAKNWGWFDAKNPAATFTGSLEKAAAYIDTHIDIANRLGKPTVLEEFGLDRDGGAFAADSGTQYRDI
YYQTVFNQLHERAVAGDAIAGYNIWAWGGYGRSQRADFIWQPGDDFMGDPPQEPQGLNSVLASDASTLAI
IKQSTADFASLAVTEKTALP