Welcome, please Login here

» Acetyl xylan esterase

  • GBP
  • USD
  • Euro
  • Catalog #
    Size
    Price
    Qty
     
  • PRO-E0055-410 U
    410 U
    10.00
  • PRO-E0055-1 mg
    1 mg
    10.00
  • PRO-E0055-4100 U
    4100 U
    70.00
  • PRO-E0055-10 mg
    10 mg
    70.00
  • PRO-E0055-41 KU
    41 KU
    450.00
  • PRO-E0055-100 mg
    100 mg
    450.00
  • PRO-E0055-1 g
    1 g
    1,900.00
  • PRO-E0055-410 KU
    410 KU
    1,900.00

Catalogue No.:
PRO-E0055

LOT:
2012-0055-1

Source Organism:
Cellvibrio japonicus NCIMB 10462

Enzyme Properties


  • PDF Downloads
  • Product Specification Sheet
    Download
  • Material Safety Data Sheet
    Download

EC No.:
3.1.1.72

Synonyms:
Acetylxylan esterase

Nomenclature:
CAZy [CE2, carbohydrate esterase family 2], ce2B, axe2A, CJA_3103, pJF122, 02313

Specific Activity:
410.0 U/mg

Accession No.:
B3PDE5, ACE85322.1, YP_001983557.1

Molecular Weight:
39090.9 Da

Biological Function:
Deacetylation of xylans and xylo-oligosaccharides

Comments:
Also catalyses the hydrolysis of acetyl groups from acetylated xylose, acetylated glucose, α-napthyl acetate, and p-nitrophenyl acetate

Primary Sequence


MADSTKPLPLHIGGRVLVESPANQPVSYTYSWPAVYFETAFKGQSLTLKFDDDQNIFRLIVDDKAPVVIN
KPGKVDYPVESLAPGKHRVRLEKLTETQSTSGRFLGFYTDPSAKPLALPKRKRQIEFIGDSFTVGYGNTS
PSRECTDEELFKTTNSQMAFGPLTAKAFDADYQINASSGFGIVRNYNGTSPDKSLLSLYPYTLNNPDQLY
HNKHWKPQVIVIGLGTNDFSTALNDNERWKTREALHADYVANYVKFVKQLHSNNARAQFILMNSDQSNGE
IAEQVGKVVAQLKGGGLHQVEQIVFKGLDYSGCHWHPSANDDQLLANLLITHLQQKKGIW