Welcome, please Login here

» Pullulanase

  • GBP
  • Euro
  • USD

Your currency for this session has been set to USD.

  • Catalog #
    Size
    Price
    Qty
     
  • PRO-E0401-254 U
    254 U
    $15.00
  • PRO-E0401-3 mg
    3 mg
    $15.00
  • PRO-E0401-2540 U
    2540 U
    $105.00
  • PRO-E0401-30 mg
    30 mg
    $105.00
  • PRO-E0401-25.4 KU
    25.4 KU
    $675.00
  • PRO-E0401-300 mg
    300 mg
    $675.00
  • PRO-E0401-254 KU
    254 KU
    $2,925.00
  • PRO-E0401-3 g
    3 g
    $2,925.00

Catalogue No.:
PRO-E0401

LOT:
2009-0401

Source Organism:
Bacillus subtilis subsp. subtilis str. 168

Enzyme Properties


  • PDF Downloads
  • Product Specification Sheet
    Download
  • Material Safety Data Sheet
    Download

EC No.:
3.2.1.41

Synonyms:
Limit dextrinase (erroneous); amylopectin 6-glucanohydrolase; bacterial debranching enzyme; debranching enzyme; α-dextrin endo-1,6-α-glucosidase; R-enzyme; pullulan α-1,6-glucanohydrolase; pullulan 6-α-glucanohydrolase; alpha-dextrin endo-1,6-alpha-glucosidase; pullulan alpha-1,6-glucanohydrolase; pullulan 6-alpha-glucanohydrolase

Nomenclature:
CAZy [GH13 subf14, glycoside hydrolase family 13 subfamily 14, member of clan GH-H], amyX, BSU29930

Specific Activity:
84.66 U/mg (9.04 mg/mL soluble starch; Sigma S-9765)

Accession No.:
O34587, NP_390871.1, AAC00283.1, BSUB224308:BSU2989-MON

Molecular Weight:
84420.4 Da

Biological Function:
Catalyses the hydrolysis of (1→6)-α-D-glucosidic linkages in pullulan, amylopectin and glycogen, and in the α- and β-limit dextrins of amylopectin and glycogen. See also EC 3.2.1.33 and EC 2.4.1.25

Comments:
PDB: 2E8Y, 2E8Z, 2E9B. Different to limit dextrinase (EC 3.2.1.142)

Primary Sequence


MVSIRRSFEAYVDDMNIITVLIPAEQKEIMTPPFRLETEITDFPLAVREEYSLEAKYKYVCVSDHPVTFG
KIHCVRASSGHKTDLQIGAVIRTAAFDDEFYYDGELGAVYTADHTVFKVWAPAATSAAVKLSHPNKSGRT
FQMTRLEKGVYAVTVTGDLHGYEYLFCICNNSEWMETVDQYAKAVTVNGEKGVVLRPDQMKWTAPLKPFS
HPVDAVIYETHLRDFSIHENSGMINKGKYLALTETDTQTANGSSSGLAYVKELGVTHVELLPVNDFAGVD
EEKPLDAYNWGYNPLHFFAPEGSYASNPHDPQTRKTELKQMINTLHQHGLRVILDVVFNHVYKRENSPFE
KTVPGYFFRHDECGMPSNGTGVGNDIASERRMARKFIADCVVYWLEEYNVDGFRFDLLGILDIDTVLYMK
EKATKAKPGILLFGEGWDLATPLPHEQKAALANAPRMPGIGFFNDMFRDAVKGNTFHLKATGFALGNGES
AQAVMHGIAGSSGWKALAPIVPEPSQSINYVESHDNHTFWDKMSFALPQENDSRKRSRQRLAVAIILLAQ
GVPFIHSGQEFFRTKQGVENSYQSSDSINQLDWDRRETFKEDVHYIRRLISLRKAHPAFRLRSAADIQRH
LECLTLKEHLIAYRLYDLDEVDEWKDIIVIHHASPDSVEWRLPNDIPYRLLCDPSGFQEDPTEIKKTVAV
NGIGTVILYLASDLKSFA