Welcome, please Login here

» Glucan 1,4-α-maltohydrolase

  • GBP
  • USD
  • Euro

Under Development

Catalogue No.:
PRO-E0402

LOT:
2009-0402

Source Organism:
Bacillus subtilis subsp. subtilis str. 168

Enzyme Properties


  • PDF Downloads
  • Product Specification Sheet
    Download
  • Material Safety Data Sheet
    Download

EC No.:
3.2.1.133

Synonyms:
Maltogenic α-amylase; 1,4-α-D-glucan α-maltohydrolase; 4-α-D-glucan α-maltohydrolase; glucan 1,4-alpha-maltohydrolase; maltogenic alpha-amylase; 1,4-alpha-D-glucan alpha-maltohydrolase; 4-alpha-D-glucan alpha-maltohydrolase

Nomenclature:
CAZy [GH13 subf20, glycoside hydrolase family 13 subfamily 20, member of clan GH-H], YvdF, BSU34620

Specific Activity:
-

Accession No.:
O06988, NP_391342.1, CAB08035.1, BSUB224308:BSU3459-MON

Molecular Weight:
72673.8 Da

Biological Function:
Catalyses the hydrolysis of (1→4)-α-D-glucosidic linkages in polysaccharides so as to remove successive α-maltose residues from the non-reducing ends of the chains

Comments:
98 % identical to the dimeric intracellular maltogenic amylase from Bacillus subtilis SUH4-2 (Ref. 1). Produces α-maltose from starch and related oligo- and polysaccharides

Primary Sequence


MMEYAAIHHQPFSTDAYSYDGRTVHIKIRTKKGDADHIRFIWGDPYEYNDGKWSANEQPMRKIAATEMHD
YWFAEVVPPFRRLQYAFVVTDDHEDIFFGSSGVCPYNEKTLETIHYYFKFPFVHEADTFQAPEWVKSTVW
YQIFPERFANGREDLSPKNALPWGSKDPDVNDFFGGDLQGIVDKLDYLEDLGVNGIYLTPIFSAPSNHKY
DTLDYFSIDPHFGDPELFRTLVSQLHQRGMRIMLDAVFNHIGSASPQWQDVVKNGDQSRYKDWFHIHSFP
VTDDNYDRFAFTADMPKLNTANPEVQKYLLDIALYWIREFDIDGWRLDVANEVDHVFWKTFRQAVSTEKP
DVYILGEIWHSAEPWLRGDEFHAAMNYPFTEPMIEYFADQTISASRMAHRVNAHLMNGMKQANEVMFNLL
DSHDTKRLLTRCRNDEKKARALLAFMFAQTGSPCIYYGTEIGLNGENDPLCRKCMVWEKEKQNQDMLQFM
KRLIALRKQENTLLTEGHLEWNLLDDKNDFISFSRTLDEKILIYFFNQGNVVQHVSLRELNIDRNKKICD
AWTEQPLQHHDVIAVQPGEFLILSAAAPV