Welcome, please Login here

» α-Amylase

  • GBP
  • USD
  • Euro
  • Catalog #
    Size
    Price
    Qty
     
  • PRO-E0403-17.8 KU
    17.8 KU
    10.00
  • PRO-E0403-4 mg
    4 mg
    10.00
  • PRO-E0403-178 KU
    178 KU
    70.00
  • PRO-E0403-40 mg
    40 mg
    70.00
  • PRO-E0403-1.78 MU
    1.78 MU
    450.00
  • PRO-E0403-400 mg
    400 mg
    450.00
  • PRO-E0403-17.8 MU
    17.8 MU
    1,950.00
  • PRO-E0403-4 g
    4 g
    1,950.00

Catalogue No.:
PRO-E0403

LOT:
2009-0403

Source Organism:
Bacillus subtilis subsp. subtilis str. 168

Enzyme Properties


  • PDF Downloads
  • Product Specification Sheet
    Download
  • Material Safety Data Sheet
    Download

EC No.:
3.2.1.1

Synonyms:
Glycogenase; α amylase, α-amylase; endoamylase; Taka-amylase A; 1,4-α-D-glucan glucanohydrolase; 4-α-D-glucan glucanohydrolase; alpha-amylase; alpha amylase, alpha-amylase; 1,4-alpha-D-glucan glucanohydrolase; 4-alpha-D-glucan glucanohydrolase

Nomenclature:
CAZy [GH13 subf28, glycoside hydrolase family 13 subfamily 28, member of clan GH-H], AmyE, AmyA; BSU03040

Specific Activity:
4449.51 U/mg (soluble starch)

Accession No.:
P00691, NP_388186.1, BG10473, BSUB224308:BSU0305-MON

Molecular Weight:
72550.6 Da

Biological Function:
Endohydrolysis of (1→4)-α-D-glucosidic linkages in polysaccharides containing three or more (1→4)-α-linked D-glucose units

Comments:
PDB: 1BAG, 1UA7. Acts on starch, glycogen and related polysaccharides and oligosaccharides in a random manner; reducing groups are liberated in the α-configuration

Primary Sequence


LTAPSIKSGTILHAWNWSFNTLKHNMKDIHDAGYTAIQTSPINQVKEGNQGDKSMSNWYWLYQPTSYQIG
NRYLGTEQEFKEMCAAAEEYGIKVIVDAVINHTTSDYAAISNEVKSIPNWTHGNTQIKNWSDRWDVTQNS
LLGLYDWNTQNTQVQSYLKRFLDRALNDGADGFRFDAAKHIELPDDGSYGSQFWPNITNTSAEFQYGEIL
QDSASRDAAYANYMDVTASNYGHSIRSALKNRNLGVSNISHYASDVSADKLVTWVESHDTYANDDEESTW
MSDDDIRLGWAVIASRSGSTPLFFSRPEGGGNGVRFPGKSQIGDRGSALFEDQAITAVNRFHNVMAGQPE
ELSNPNGNNQIFMNQRGSHGVVLANAGSSSVSINTATKLPDGRYDNKAGAGSFQVNDGKLTGTINARSVA
VLYPDDIAKAPHVFLENYKTGVTHSFNDQLTITLRADANTTKAVYQINNGPDDRRLRMEINSQSEKEIQF
GKTYTIMLKGTNSDGVTRTEKYSFVKRDPASAKTIGYQNPNHWSQVNAYIYKHDGSRVIELTGSWPGKPM
TKNADGIYTLTLPADTDTTNAKVIFNNGSAQVPGQNQPGFDYVLNGLYNDSGLSGSLPH