Welcome, please Login here

» Glycogen branching enzyme

  • GBP
  • Euro
  • USD
  • Catalog #
    Size
    Price
    Qty
     
  • PRO-E0406-15.4
    15.4U
    10.00
  • PRO-E0406-1
    1mg
    10.00
  • PRO-E0406-154
    154U
    70.00
  • PRO-E0406-10
    10mg
    70.00
  • PRO-E0406-1544
    1544U
    450.00
  • PRO-E0406-100
    100mg
    450.00

Catalogue No.:
PRO-E0406

LOT:
2009-0406

Source Organism:
Escherichia coli str. K-12 substr. W3110

Enzyme Properties


  • PDF Downloads
  • Product Specification Sheet
    Download
  • Material Safety Data Sheet
    Download

EC No.:
2.4.1.18

Synonyms:
1,4-α-Glucan branching enzyme; branching enzyme; amylo-(1,4→1,6)-transglycosylase; Q-enzyme; α-glucan-branching glycosyltransferase; amylose isomerase; enzymatic branching factor; branching glycosyltransferase; enzyme Q; glucosan transglycosylase; glycogen branching enzyme; plant branching enzyme; α-1,4-glucan:α-1,4-glucan-6-glycosyltransferase; starch branching enzyme; 1,4-α-D-glucan:1,4-α-D-glucan 6-α-D-(1,4-α-D-glucano)-transferase; 1,4-alpha-glucan branching enzyme; alpha-glucan-branching glycosyltransferase; alpha-1,4-glucan: alpha-1,4-glucan-6-glycosyltransferase; 1,4- alpha-D-glucan:1,4-alpha-D-glucan 6-alpha-D-(1,4-alpha-D-glucano)-transferase

Nomenclature:
CAZy [GH13 subf9, glycoside hydrolase family 13 subfamily 9, member of clan GH-H]

Specific Activity:
15.44 U/mg

Accession No.:
BAE77860

Molecular Weight:
88157.0 Da

Biological Function:
Transfers a segment of a (1->4)-α-D-glucan chain to a primary hydroxy group in a similar glucan chain

Comments:
Converts amylose into amylopectin. The description (official name) requires a qualification depending on the product, glycogen or amylopectin, e.g. glycogen branching enzyme, amylopectin branching enzyme. The latter has frequently been termed Q-enzyme

Primary Sequence


MSDRIDRDVINALIAGHFADPFSVLGMHKTTAGLEVRALLPDATDVWVIEPKTGRKLAKLECLDSRGFFS
GVIPRRKNFFRYQLAVVWHGQQNLIDDPYRFGPLIQEMDAWLLSEGTHLRPYETLGAHADTMDGVTGTRF
SVWAPNARRVSVVGQFNYWDGRRHPMRLRKESGIWELFIPGAHNGQLYKYEMIDANGNLRLKSDPYAFEA
QMRPETASLICGLPEKVVQTEERKKANQFDAPISIYEVHLGSWRRHTDNNFWLSYRELADQLVPYAKWMG
FTHLELLPINEHPFDGSWGYQPTGLYAPTRRFGTRDDFRYFIDAAHAAGLNVILDWVPGHFPTDDFALAE
FDGTNLYEHSDPREGYHQDWNTLIYNYGRREVSNFLVGNALYWIERFGIDALRVDAVASMIYRDYSRKEG
EWIPNEFGGRENLEAIEFLRNTNRILGEQVSGAVTMAEESTDFPGVSRPQDMGGLGFWYKWNLGWMHDTL
DYMKLDPVYRQYHHDKLTFGILYNYTENFVLPLSHDEVVHGKKSILDRMPGDAWQKFANLRAYYGWMWAF
PGKKLLFMGNEFAQGREWNHDASLDWHLLEGGDNWHHGVQRLVRDLNLTYRHHKAMHELDFDPYGFEWLV
VDDKERSVLIFVRRDKEGNEIIVASNFTPVPRHDYRFGINQPGKWREILNTDSMHYHGSNAGNGGTVHSD
EIASHGRQHSLSLTLPPLATIWLVREAE