Welcome, please Login here

» Isoamylase

  • GBP
  • Euro
  • USD
  • Catalog #
    Size
    Price
    Qty
     
  • PRO-E0407-1 mg
    1 mg
    10.00
  • PRO-E0407-10 mg
    10 mg
    70.00
  • PRO-E0407-100 mg
    100 mg
    450.00
  • PRO-E0407-1 g
    1 g
    2,700.00

Catalogue No.:
PRO-E0407

LOT:
2009-0407

Source Organism:
Escherichia coli str. K-12 substr. W3110

Enzyme Properties


  • PDF Downloads
  • Product Specification Sheet
    Download
  • Material Safety Data Sheet
    Download

EC No.:
3.2.1.68

Synonyms:
Debranching enzyme; glycogen α-1,6-glucanohydrolase; glycogen alpha-1,6-glucanohydrolase

Nomenclature:
CAZy [GH13 subf11, glycoside hydrolase family 13 subfamily 11, member of clan GH-H]

Specific Activity:
-

Accession No.:
BAE77861

Molecular Weight:
77396.8 Da

Biological Function:
Catalyses the hydrolysis of (1→6)-α-D-glucosidic branch linkages in glycogen, amylopectin and their β-limit dextrins

Comments:
Differs from EC 3.2.1.41 (pullulanase) and EC 3.2.1.142 (limit dextrinase) by its inability to hydrolyse pullulan, and by limited action on α-limit dextrins. Maltose is the smallest sugar it can release from an α-(1→6)-linkage

Primary Sequence


MTQLAIGKPAPLGAHYDGQGVNFTLFSAHAERVELCVFDANGQEHRYDLPGHSGDIWHGYLPDARPGLRY
GYRVHGPWQPAEGHRFNPAKLLIDPCARQIDGEFKDNPLLHAGHNEPDYRDNAAIAPKCVVVVDHYDWED
DAPPRTPWGSTIIYEAHVKGLTYLHPEIPVEIRGTYKALGHPVMINYLKQLGITALELLPVAQFASEPRL
QRMGLSNYWGYNPVAMFALHPAYACSPETALDEFRDAIKALHKAGIEVILDIVLNHSAELDLDGPLFSLR
GIDNRSYYWIREDGDYHNWTGCGNTLNLSHPAVVDYASACLRYWVETCHVDGFRFDLAAVMGRTPEFRQD
APLFTAIQNCPVLSQVKLIAEPWDIAPGGYQVGNFPPLFAEWNDHFRDAARRFWLHYDLPLGAFAGRFAA
SSDVFKRNGRLPSAAINLVTAHDGFTLRDCVCFNHKHNEANGEENRDGTNNNYSNNHGKEGLGGSLDLVE
RRRDSIHALLTTLLLSQGTPMLLAGDEHGHSQHGNNNAYCQDNQLTWLDWSQASSGLTAFTAALIHLRKR
IPALVENRWWEEGDGNVRWLNRYAQPLSTDEWQNGPKQLQILLSDRFLIAINATLEVTEIVLPAGEWHAI
PPFAGEDNPVITAVWQGPAHGLCVFQR