Welcome, please Login here

» Sucrose phosphorylase

  • GBP
  • Euro
  • USD

Under Development

Catalogue No.:
PRO-E0408

LOT:
2009-0408

Source Organism:
Escherichia coli str. K-12 substr. W3110

Enzyme Properties


EC No.:
2.4.1.7

Synonyms:
Sucrose glucosyltransferase; disaccharide glucosyltransferase; sucrose:phosphate α-D-glucosyltransferase; sucrose:phosphate alpha-D-glucosyltransferase

Nomenclature:
CAZy [GH13 subf18, glycoside hydrolase family 13 subfamily 18, member of clan GH-H]

Specific Activity:
-

Accession No.:
BAA14886

Molecular Weight:
68006.0 Da

Biological Function:
Catalyses the reaction: sucrose + phosphate = D-fructose + α-D-glucose 1-phosphate

Comments:
Phosphate can be replaced by arsenate, and D-fructose with L-arabinose and some ketoses

Primary Sequence


MKQKITDYLDEIYGGTFTATHLQKLVTRLESAKRLITQRRKKHWDESDVVLITYADQFHSNDLKPLPTFN
QFYHQWLQSIFSHVHLLPFYPWSSDDGFSVIDYHQVASEAGEWQDIQQLGECSHLMFDFVCNHMSAKSEW
FKNYLQQHPGFEDFFIAVDPQTDLSAVTRPRALPLLTPFQMRDHSTRHLWTTFSDDQIDLNYRSPEVLLA
MVDVLLCYLAKGAEYVRLDAVGFMWKEPGTSCIHLEKTHLIIKLLRSIIDNVAPGTVIITETNVPHKDNI
AYFGAGDDEAHMVYQFSLPPLVLHAVQKQNVEALCAWAQNLTLPSSNTTWFNFLASHDGIGLNPLRGLLP
ESEILELVEALQQEGALVNWKNNPDGTRSPYEINVTYMDALSRRESSDEERCARFILAHAILLSFPGVPA
IYIQSILGSRNDYAGVEKLGYNRAINRKKYHSKEITRELNDEATLRHAVYHELSRLITLRRSHNEFHPDN
NFTIDTINSSVMRIPRSNADGNCLTGLFNVSKNIQHVNITNLHGRDLISEVDILGNEITLRPWQVMWIK