Welcome, please Login here

» α-Amylase

  • GBP
  • USD
  • Euro
  • Catalog #
    Size
    Price
    Qty
     
  • PRO-E0409-23.6 U
    23.6 U
    10.00
  • PRO-E0409-1 mg
    1 mg
    10.00
  • PRO-E0409-236.1 U
    236.1 U
    70.00
  • PRO-E0409-10 mg
    10 mg
    70.00
  • PRO-E0409-2361 U
    2361 U
    450.00
  • PRO-E0409-100 mg
    100 mg
    450.00
  • PRO-E0409-23610 U
    23610 U
    1,950.00
  • PRO-E0409-1 g
    1 g
    1,950.00

Catalogue No.:
PRO-E0409

LOT:
2009-0409

Source Organism:
Escherichia coli str. K-12 substr. W3110

Enzyme Properties


  • PDF Downloads
  • Product Specification Sheet
    Download
  • Material Safety Data Sheet
    Download

EC No.:
3.2.1.1

Synonyms:
Glycogenase; α amylase, α-amylase; endoamylase; Taka-amylase A; 1,4-α-D-glucan glucanohydrolase; 4-α-D-glucan glucanohydrolase; alpha-amylase; alpha amylase, alpha-amylase; 1,4-alpha-D-glucan glucanohydrolase; 4-alpha-D-glucan glucanohydrolase

Nomenclature:
CAZy [GH13 subf5, glycoside hydrolase family 13 subfamily 5, member of clan GH-H], cytoplasmic α-amylase, amyA, yedC, b1927, JW1912

Specific Activity:
23.61 U/mg (soluble starch)

Accession No.:
P26612, NP_416437.1, EG11387, ALPHA-AMYL-CYTO-MON

Molecular Weight:
60459.5 Da

Biological Function:
Endohydrolysis of (1->4)-α-D-glucosidic linkages in oligosaccharides and polysaccharides

Comments:
This cytoplasmic enzyme acts on starch, glycogen and related polysaccharides

Primary Sequence


MRNPTLLQCFHWYYPEGGKLWPELAERADGFNDIGINMVWLPPAYKGASGGYSVGYDSYDLFDLGEFDQK
GSIPTKYGDKAQLLAAIDALKRNDIAVLLDVVVNHKMGADEKEAIRVQRVNADDRTQIDEEIIECEGWTR
YTFPARAGQYSQFIWDFKCFSGIDHIENPDEDGIFKIVNDYTGEGWNDQVDDELGNFDYLMGENIDFRNH
AVTEEIKYWARWVMEQTQCDGFRLDAVKHIPAWFYKEWIEHVQEVAPKPLFIVAEYWSHEVDKLQTYIDQ
VEGKTMLFDAPLQMKFHEASRMGRDYDMTQIFTGTLVEADPFHAVTLVANHDTQPLQALEAPVEPWFKPL
AYALILLRENGVPSVFYPDLYGAHYEDVGGDGQTYPIDMPIIEQLDELILARQRFAHGVQTLFFDHPNCI
AFSRSGTDEFPGCVVVMSNGDDGEKTIHLGENYGNKTWRDFLGNRQERVVTDENGEATFFCNGGSVSVWV
IEEVI