Welcome, please Login here

» α-Glucosidase

  • GBP
  • USD
  • Euro
  • Catalog #
    Size
    Price
    Qty
     
  • PRO-E0410-34.1 U
    34.1 U
    10.00
  • PRO-E0410-1 mg
    1 mg
    10.00
  • PRO-E0410-341 U
    341 U
    70.00
  • PRO-E0410-10 mg
    10 mg
    70.00
  • PRO-E0410-3410 U
    3410 U
    450.00
  • PRO-E0410-100 mg
    100 mg
    450.00
  • PRO-E0410-34.1 KU
    34.1 KU
    1,950.00
  • PRO-E0410-1 g
    1 g
    1,950.00

Catalogue No.:
PRO-E0410

LOT:
2009-0410

Source Organism:
Escherichia coli str. K-12 substr. W3110

Enzyme Properties


  • PDF Downloads
  • Product Specification Sheet
    Download
  • Material Safety Data Sheet
    Download

EC No.:
3.2.1.20

Synonyms:
Maltase; acid maltase; glucoinvertase; glucosidosucrase; lysosomal α-glucosidase; maltase-glucoamylase; α-glucopyranosidase; glucosidoinvertase; α-D-glucosidase; α-glucoside hydrolase; α-1,4-glucosidase; α-D-glucoside glucohydrolase; alpha-glucosidase; alpha-glucopyranosidase; alpha-D-glucosidase; alpha-glucoside hydrolase; alpha-1,4-glucosidase; lysosomal alpha-glucosidase; alpha-D-glucoside glucohydrolase

Nomenclature:
CAZy [GH13 subf21, glycoside hydrolase family 13 subfamily 21, member of clan GH-H]

Specific Activity:
34.1 U/mg (soluble starch)

Accession No.:
BAE76183

Molecular Weight:
72992.3 Da

Biological Function:
Hydrolysis of terminal, non-reducing (1→4)-linked α-D-glucose residues with release of α-D-glucose

Comments:
Specificity directed mainly towards the exohydrolysis of 1,4-α-glucosidic linkages

Primary Sequence


MMLNAWHLPVPPFVKQSKDQLLITLWLTGEDPPQRIMLRTEHDNEEMSVPMHKQRSQPQPGVTAWRAAID
LSSGQPRRRYSFKLLWHDRQRWFTPQGFSRMPPARLEQFAVDVPDIGPQWAADQIFYQIFPDRFARSLPR
EAEQDHVYYHHAAGQEIILRDWDEPVTAQAGGSTFYGGDLDGISEKLPYLKKLGVTALYLNPVFKAPSVH
KYDTEDYRHVDPQFGGDGALLRLRHNTQQLGMRLVLDGVFNHSGDSHAWFDRHNRGTGGACHNPESPWRD
WYSFSDDGTALDWLGYASLPKLDYQSESLVNEIYRGEDSIVRHWLKAPWNMDGWRLDVVHMLGEAGGARN
NMQHVAGITEAAKETQPEAYIVGEHFGDARQWLQADVEDAAMNYRGFTFPLWGFLANTDISYDPQQIDAQ
TCMAWMDNYRAGLSHQQQLRMFNQLDSHDTARFKTLLGRDIARLPLAVVWLFTWPGVPCIYYGDEVGLDG
KNDPFCRKPFPWQVEKQDTALFALYQRMIALRKKSQALRHGGCQVLYAEDNVVVFVRVLNQQRVLVAINR
GEACEVVLPASPFLNAVQWQCKEGHGQLTDGILALPAISATVWMN