Welcome, please Login here

» Trehalose-6-phosphate hydrolase

  • GBP
  • Euro
  • USD

Your currency for this session has been set to GBP.

  • Catalog #
    Size
    Price
    Qty
     
  • PRO-E0411-504.8 U
    504.8 U
    10.00
  • PRO-E0411-2 mg
    2 mg
    10.00
  • PRO-E0411-5048 U
    5048 U
    70.00
  • PRO-E0411-20 mg
    20 mg
    70.00
  • PRO-E0411-50.48 KU
    50.48 KU
    450.00
  • PRO-E0411-200 mg
    200 mg
    450.00
  • PRO-E0411-504.8 KU
    504.8 KU
    1,950.00
  • PRO-E0411-2 g
    2 g
    1,950.00

Catalogue No.:
PRO-E0411

LOT:
2009-0411

Source Organism:
Escherichia coli str. K-12 substr. W3110

Enzyme Properties


  • PDF Downloads
  • Product Specification Sheet
    Download
  • Material Safety Data Sheet
    Download

EC No.:
3.2.1.93

Synonyms:
α,α-Trehalose-6-phosphate phosphoglucohydrolase; α,α-phosphotrehalase; phosphotrehalase; alpha,alpha-trehalose-6-phosphate phosphoglucohydrolase; alpha,alpha-phosphotrehalase

Nomenclature:
CAZy [GH13 subf29, glycoside hydrolase family 13 subfamily 29, member of clan GH-H], treC, olgH, b4239, JW4198

Specific Activity:
252.4 U/mg (5 mM PNPG)

Accession No.:
P28904, AP_004737.1, NP_418660.1

Molecular Weight:
67657.8 Da

Biological Function:
α,α-Trehalose 6-phosphate + H2O <=> D-glucose + D-glucose 6-phosphate

Comments:
-

Primary Sequence


MTHLPHWWQNGVIYQIYPKSFQDTTGSGTGDLRGVIQHLDYLHKLGVDAIWLTPFYVSPQVDNGYDVANY
TAIDPTYGTLDDFDELVTQAKSRGIRIILDMVFNHTSTQHAWFREALNKESPYRQFYIWRDGEPETPPNN
WRSKFGGSAWRWHAESEQYYLHLFAPEQADLNWENPAVRAELKKVCEFWADRGVDGLRLDVVNLISKDPR
FPEDLDGDGRRFYTDGPRAHEFLHEMNRDVFTPRGLMTVGEMSSTSLEHCQRYAALTGSELSMTFNFHHL
KVDYPGGEKWTLAKPDFVALKTLFRHWQQGMHNVAWNALFWCNHDQPRIVSRFGDEGEYRVPAAKMLAMV
LHGMQGTPYIYQGEEIGMTNPHFTRITDYRDVESLNMFAELRNDGRDADELLAILASKSRDNSRTPMQWS
NGDNAGFTAGEPWIGLGDNYQQINVEAALADDSSVFYTYQKLIALRKQEAILTWGNYQDLLPNSPVLWCY
RREWKGQTLLVIANLSREIQPWQAGQMRGNWQLVMHNYEEASPQPCAMNLRPFEAVWWLQK